rna3626 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507620.1
Unique Namerna3626
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:113911..123385 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507620.1
ProductDNA-binding protein Ewg-like, transcript variant X3
Model evidenceSupporting evidence includes similarity to: 2 ESTs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161277
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507620.1
GeneID107161277
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161277gene2456Diuraphis noxiageneJOTR01000065 113911..123385 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507620.1rna3626Diuraphis noxiapolypeptideJOTR01000065 115023..118683 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363106.1cds3530Diuraphis noxiaCDSJOTR01000065 115023..115253 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31682id31682Diuraphis noxiaexonJOTR01000065 113911..115253 -
id31681id31681Diuraphis noxiaexonJOTR01000065 115321..115400 -
id31680id31680Diuraphis noxiaexonJOTR01000065 116278..116440 -
id31679id31679Diuraphis noxiaexonJOTR01000065 116517..116645 -
id31678id31678Diuraphis noxiaexonJOTR01000065 116707..116958 -
id31677id31677Diuraphis noxiaexonJOTR01000065 117022..117134 -
id31676id31676Diuraphis noxiaexonJOTR01000065 117563..117758 -
id31675id31675Diuraphis noxiaexonJOTR01000065 117821..117937 -
id31674id31674Diuraphis noxiaexonJOTR01000065 117999..118123 -
id31673id31673Diuraphis noxiaexonJOTR01000065 118518..118705 -
id31672id31672Diuraphis noxiaexonJOTR01000065 118776..118882 -
id31671id31671Diuraphis noxiaexonJOTR01000065 123298..123385 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3626 ID=rna3626|Name=XM_015507620.1|organism=Diuraphis noxia|type=mRNA|length=2901bp|location=Sequence derived from alignment at JOTR01000065:113911..123385- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
GGGCGATGGACTCGGCCAACACGGGCACTGCCGCCGCCGCCGTCGACGCC
GACGCCGACGCCGCAGCCGCCGTTCTCCCGTCACGCAGATTATTCAACWT
GGATTTCAATCAGAAATTATATTTTATCGGGAATTAAAATTGTTCAATAT
TGAAGATTTCAATTGAGTATTTGACTGAATTTTTAAACTTGTGAGGTCGT
TTTTAAAATTAATCATTATGATGGATCGTAGTGGAAATGATATTAATATG
ACTGGAGACAGTGATCTAGATGATGATGGTTGTTTGTCTTCTGATGACTG
TGATGGAGACTCTAACCAGAGTAAAAGTGATTTAATGTCTGCAGCAATGG
GAGATGATGTTACTGCACAGCTTGCTGCAGCAGGACCAGTTGGAATGGCT
GCTGCTGCTGCAATTGTGTCATCAAAAAAGAGAAAAAGACCACATTCATT
TGAGACCAATCCATCAATTCGAAAACGACAGCACAATCGGTTACTACGTA
AACTCAAAGTTACCATTGATGAGTTTGCTACCAGAGTTGGTCAACAAGCA
ATCGTATTAGTGGCAACACCTGGGAAAGAAACCACAGGTTTTAAATGCTT
TGGTGCAAAACCTTTAGAAGATGTTGTAAAAAATTTACGTGCCACTATTA
TGGACCAACTGGATACTGCATTAGCACAACATGCACCACCACCTATTCCA
GATGACCCTACTCTATATGAGCTACCACCACTCATTTTAGATGGAATTCC
AACTCCTGTTGAAAAAATGACCCAGGCTCAATTAAGAGCTTTTATACCTT
TAATGTTGAAGTATTCCACAGGTAGAGGGAAACCTGGTTGGGGCAGAGAA
AGTACCAGGCCACCTTGGTGGCCCAATGAATTACCTTGGGCAAATGTTAG
AATGGATGCTCGATGTGAGGATGAGAAACAAAAAATTTCTTGGACAAGAG
CATTACGACAGATTGTTATAAACTGTTATAAATACCATGGTCGAGAAGAT
TTATTGCCTACATTTAGCGAAGAAGATGAGGCAAAAACAATTGTTAATAA
TGTTGCAAGTCAATCTATCGTTACTTCTGTGCTCAAATTCAATCCTAAAG
CAACTAGTATTGAAGCTCGAAGTTCACCAGATGCACAGGAACAACAACAA
CAACAACAACAACAACAACAACAACAACTAACCCAGGTACAGTATTCTCC
GGCATTCCTCCATTCTATTAGTAATGTTGATGGGTCAATGTCCATATTTC
ATGTTGATCCAAATAACCCAATTATTACGTTACCTGATGGAACACAGGCC
CATGTTCAAGGAGTTATAAATGCTTCCCAAGGACCAAATGGGCACACAGT
TCATTCTGTTCATACCCTTGGTGAAGGCCAAAATCAAGATGGTGTAACTG
TAGATATATTAAATAATGTACCTGAAGCCACATTAAATCAAGAAGGTCAA
ATAATTATTACTGGTGAAGATGGACAAGTATCAAGCATGATAACAGTCCC
TGTAAGTACTTCATTATACCAAAGTGTTTGTCAACAAATAAGTGAAGGTA
GCATACAGGTTGTCACCCCGGTTATGCATCATATGCCTAAGTCTGAGCCC
GGTGGTGGGATGGATTCATCAAATTGTGAAGTGGAAACCATTAATGTGCC
ACATCAGTTGGTAGCCATCACCGGGCAAAATGGCGAACAAGTGTTGCAGT
TGATTTCATTAAAAGATAATAAACTGATCAATGCTACAGTTGGCGATATT
AAAGAAGAAGGCACTAACATGTCTAATTCAGACCAATGAGAACAACTTCA
ACATTACCTGTGCTTTGATGACCTTGGCAAATAAATTTTAAATAATATAG
GGTAATGACTATCGGTATTTTTACTTCTTAAATGTATTATATATCTGTGT
GCATGTGATTTAATAATGGTTATATATATATATATATATATATACCTTTT
TGTTCTGCCCTCAAACATGTGTATAAATATAATATAATATATATTTTTAT
CACTTCCATATGATTCAGATAATTTACTCTTCTAAAACTTAGAGTAAATC
ATCTTTTCTATACAAATTTTAAATATTATAATATCGTAATTTTGTTCTTG
GTTTAAACTTTCWTAGAAGTTTTTATTATACATTACTCTAGTGTTTGGGA
TTTTCTAATTGTAGAAAAATAAGAGTTAATAAAAAAATACAGTGAAATAC
TATTTTAAGCCTAATTAAATTAGCCTGATTTAATTGATTATTATTTACCA
TTTTGGAACTTTTAGTCTTTTAAGTTTAAAAAAGTCATACATTTTTGTGT
GGCCATGACTCTAAACCTAGTCAATATGTTAGTCCTGTAAACAATATTAC
AGAAGTTTAAGTTTTTGTTTATTTGTTTAAGATAAATATTCTCGCCCTAG
ATTTTTAGATGTTTTTATTTTTATGTGGGTTGTATTTTCTTGTAAACTGT
TTTTTCCATGTTATTTGTCACGTTCACAGACATTAATGTTAGAAAAAGTG
CAATTCTGTAAAAAAAAATTAATACCATTTTTGAATGTAATTTTTTTGTT
TCCACATTGTTGATATTGTTTATTTGAGTGTCCTTGCCTGATATATATGT
ATACATATATATATATATCAAATGTTCATGTATTTRTCTATTATATTATA
TCAATGTAAATATATACTATGTATAATATATGACTTTTTATTAAGTTAGC
TTGTTTTCTCTTTTTTTATTATTTAATTGTGTACATTTTGTAATCAATTC
AATGTGAAATCTTCATACTCAAATTTTCTGATTACTTATTTTATTATTTA
TTTTAGGTTATTAGATAATGTTATACAATACTATGTACCTATTGAATTAG
ATAATTGTTGTGTGCTGTTATCAAACATGAAACGGGACATTTATTATTAT
C
back to top

protein sequence of XM_015507620.1

>rna3626 ID=rna3626|Name=XM_015507620.1|organism=Diuraphis noxia|type=polypeptide|length=524bp
MMDRSGNDINMTGDSDLDDDGCLSSDDCDGDSNQSKSDLMSAAMGDDVTA
QLAAAGPVGMAAAAAIVSSKKRKRPHSFETNPSIRKRQHNRLLRKLKVTI
DEFATRVGQQAIVLVATPGKETTGFKCFGAKPLEDVVKNLRATIMDQLDT
ALAQHAPPPIPDDPTLYELPPLILDGIPTPVEKMTQAQLRAFIPLMLKYS
TGRGKPGWGRESTRPPWWPNELPWANVRMDARCEDEKQKISWTRALRQIV
INCYKYHGREDLLPTFSEEDEAKTIVNNVASQSIVTSVLKFNPKATSIEA
RSSPDAQEQQQQQQQQQQQQLTQVQYSPAFLHSISNVDGSMSIFHVDPNN
PIITLPDGTQAHVQGVINASQGPNGHTVHSVHTLGEGQNQDGVTVDILNN
VPEATLNQEGQIIITGEDGQVSSMITVPVSTSLYQSVCQQISEGSIQVVT
PVMHHMPKSEPGGGMDSSNCEVETINVPHQLVAITGQNGEQVLQLISLKD
NKLINATVGDIKEEGTNMSNSDQ.
back to top

mRNA from alignment at JOTR01000065:113911..123385-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3626 ID=rna3626|Name=XM_015507620.1|organism=Diuraphis noxia|type=mRNA|length=9475bp|location=Sequence derived from alignment at JOTR01000065:113911..123385- (Diuraphis noxia)
GGGCGATGGACTCGGCCAACACGGGCACTGCCGCCGCCGCCGTCGACGCC GACGCCGACGCCGCAGCCGCCGTTCTCCCGTCACGCAGGTGCGTACGCAG CCGTACTCTGGTAATATTCATTAACGTCACCATCGGTGTGTCGCGTCGAT TCTTTTACGCCATATCATGCGTGCTGCCAATTAGGGCTTTTTTCTTTTTT TTTCTTTACCTCGGCCTGCCCGCGAAACGTCTCKTCACCCACGGCGATGA TTGCCGCTTCGGYGGAGGACCCCCCTGAGCTGGCGTTCGGTCCGGGCTCG ACCGTTTTGTTTTTCGATACACCTTCTCGCGTAATCCAATCGAAGCGGCA CACACGAACAACACGTCATGACACACACTGCGGCTGCGGCGGCGGCGGCG GTGCTTCTATAGGAACTAGGAAGTCCGTCGACGCCGACGCCGCGGTGACG ACGTTGTTGCTGCGCCTTAGGAGTTGCGCCCGGCATAATATTATTATTAT TATAATGTATGCCGTCGAGCTCCGCGACAGTAGTAGTAGTAGTAGTAGTA GTAATAGTAATAGTAGTAGTATATTAGTAATAGTAACAACTAGTAATTGT AGGCAACAATACCGTGTCGGAGACTTGTAGTAGATTCGAGGTGATATTAA CCTGAAAATAATTTGTTTTATTAGGAGCACCGCGATTGGTAGTTGGCACG CATTGTTGATTTTCCACACTGTTGAGCCTAATCTAATACTTTGCCAAATT TACAATTTCTTCTAGGTCTCTMAAATTTTCGGCTCACTGTATTACGTTAC CCCCCTCCGAAGATTATGTCGTTGTGAAACTTGATTATGCACGTCAAGTG AATAAACGGAAAAAATGTTTCGAGCACCCATACTTGATGTGCACGAGATA TGAGCTTTTTGGATTTTTTCTCCTATTTGGTTTTTACGATTTCATTCGTT TTTATCATATCGCATTTCCTTCGTTGTGGGAACGGACATTATCTAATATT AACGTTATTATGACATTTTACACGTCGTCTGGTTTCCATTGTCACTATCA ATCGCGCATATCGTTGTTTACTCCGTTATCTCAGAAATTCTCACACCCAA CAACAATGTACATGTTGACGGCATCTAAAACGTTAAAATTTCACTCATGT ACATGTTGCTCTTATGAGTTAGTATAAAACATTTTGATTACTGATTAATA TATGTCGCGACGTCCAAACTTATGTGTATAATATATAATATTATTTATAT CCATCAAAGTACATTAACATTTCGATCAAAAAATACTCTAACGTATCTTC GAGAGAATGTATTGTTTTGTTATCGGTTGTTCCTAACATTTATCTACATT CTACAATAATAGTTAGTTATTGGTTTCGAACTAACAGCATTTCTGGATAT CATCCGCCGTTATCTCATGGAAGTTATAATTATATTATACTCGTGTGGTG ATGCATAATGCATTACGAAATGTTCAAAATTATTTAAATTCAAGTTGACG GATAAAAATAATATTATCTTCATTCGTTTTAGTGGCTATATTATATTTAA TCAATTTTGAAAATTGACTACATTCGTGGCCATGAATAAAACATCAAATT ATTACTGTTAGGGATACCTTTATAGTTCATTTTATGCGTGAATATGATTT AAATAGATATTAAAACAGTTATGACAGTTTATAAGTTTTATTAATATTAC TTATTATAATGGGACTGTGGTAGAATAAAGAAGTCGTTTAGTCGTATATT ATTCATAATGTAAACAATAATTTTACCAGTGAATGTTTTTGTTTCGTGAA CTTACCGGTAGATCACGCTGCAGTCTTTTGGCTCTAGTTTTCATACTTAC ATGTAAATTGCATACAATAAATGAAGACATATTGTAATACATCAATACAA TATGTATTATAACGACATTATGMTAACTAAAAATCAACATTTATTATATT AATATTGGTTAGGTCAGTTAAAATAAAATAATTTTTTTATTAATTAATAG GTACATAACTTTAAAATATTTGAAAACTAAGTACCTACCTTAAACATTAT TTTAACTCTTCTTTTTTTCCCTGGATATTTTTTTGGATGATCAATCTTGT TTTCTTGTATTCTCTCATTCTTATATACATGTAATAATGCAAACAACTTG TCATCACACTACTCTAGCATTAATGAATTTTTTGAATTGTGGACACATAT CATCTCTTTTTTATTATTTTTGGTACAGATGAAAARGYCYTYYKGGRAWW WTTWAAAAAAAAWTTTATCTATTATKATTATTAAATACTTTTATTTGCAA GTTTCTTTCTCTCTGTAGAAGTTCAAAACCATATGGTTTCTTCTTCTTTG AAGTGTATTGTACAAACAAATGAATTTATGCTTAGTTCTATAACCCTCTT TGGTATAGCTTTTTTCCACACATCAAAATCTAATTGTTTWGCAGCAGCTT TAAACATTGAAACCTAATATGGTAAATTATATCATAGAACTTTAAAGCAA ATATAAACAGTGCTTGAATTGGTGAGGATAAGTCTTTTTCGAGAAATATT TTGGTATACACTTTAAATATATTTCAGTCAGTAAATACCGGTTACTTCAG TTTTCACTTTTGCATCACCTTGGCAATTTTTTAAAATCAGAACTCTAAAG GACGTGTTTAATAATTATAATCACAAAATTTATCCATTTTTTATTTCAAT AATCAATTTACTTTATTCTTACAAATTACATAGGTAACCGGATTTTCAAT GTACTTCATAACACTTAACCATTTTAAATAAAAACAATTGTTAAGTATTT AAATAAATTAAGAATCATATAAATGTTTGTGACATTGTGTGAATATTCTA YTTCACAACTATAATAAATTACCTGTTATTTATGAGTAAACAAAAATGAC AATTTTTATAAAGCCGAACGTTTGCAGGGTCGCTCAGTTCAGCTAGTTTT TAGTTTATTTCATCATGGTGAAAATCGTACAACAAAATAAAGTATAATAC TATAATATCATAGATAATATATAATATATGTATATAATATAATTATTATT ATAAGTTATAATATTATAAATAATCATTTTAGTTATTACTAAACAACTGT TACGCGATCTAGTGGTGAATTCTTCTTAAATATATACTTCTAAAACATGA TTTTGATAGTTATGCGAATAACTCTATTATCTACCATGCTTATAATTTAT AATATTATACACAATATGATTAAATATTTAGTCATGATTATACCACAGAT TATATAAATATATATTTATATGTTTTATATAATCTGTGATTATACCTAAA CTTAAATATTGATAACATACTTATTTGCTCTAACTATCGCCAATTCAGTA ATTCCCTTATATTATCTATGCTTAAAACTGTTACACATTTKATGATAATA AATTACTTCTATAACTACCTTCTTAAAGTATTTCAGTAGTTGTTAAATAC ATTTTAAAACTATTAAAATTACGAAGAGTTCAGACTTGGGTACTCRGATA TTTTGTTTTGTTGTACAACAAATTGTTTACTCATTAAACTTGTTATCAGA TYAAAAATACTATTGATATCCCGTTAGTCTAATATCCTTAGTTGGGTTGT AGATAAGAAAAATTGGGATTAAATATTTTAATCTACAATAGATGTTATCT TTTAGTTGCTATTAATTTTTGACTATAATATGATAATTTTTGTATTTTGG ATATTAGATATCGATATAAAATGATTTCGTTCTTGTTTTACATTTCATTC TGTGTTGTATTTTATACTATTAATGTTTCGGAGTAAAATGTTAAATTTGT AGATAAATTGTTAATTTTGTTAACTAATATATAATTTTTAAATTAATGAA CCATTARTAATATATACACACAACCATCTAATTTATCACCATGATTTTTA TGGTTATTTTTGTTTTATTATATGAGTGGGTAAGCAAATATTATAGTTTT TTATTTCACTCACCTATATTATTTTTAAAGATGAATTTTGTAACATCATT TAACAAAAATGTCTTAAATGTTACTACTTAAATTATTCAGGCAATGATAT TTTTTAACCTAACAATTGATCTACATTATTTAGAGTATTCAAAAATTTTA TTTAATATTTTAGGAATACAAATTAGATCATCTAGAAACGTGTAAAATTA TGTTAATTTGTTTAAATATTGAAGTAGACTATGACTCATTTGACATATTA TGTATATTATGTGATTTTACTATAGTTCATAATTGTGGTATCTACATAGG CGTAATTTGGGTTAGATTTATGGCGGTGCTAGATTTAAGTTGACCAAAGT CATAAATTTATCTCCTAATGCCTATGACATAAAATCATAAGTTATAAGTT TATAACCAATAACAATTTGGGAGTGCTATGCACCCTCAAGCACCCTCAAA ATTGCGCCTATGGTACCTATCTATTTCATACAGATTATTGATTTATATAT GAAATTCATAAGTAATTCATAATTTACGATTTATTAATATTTTTATTTTA TAGATTATTCAACWTGGATTTCAATCAGAAATTATATTTTATCGGGAATT AAAATTGTTCAATATTGAAGATTTCAATTGAGTATTTGACTGAATTTTTA AACTTGTGAGGTATAAAAATTTATAAAAATTTGTTTGAGTTATTAATCAA TAATTTACCTATAAAAAATTTAATTTATAGGTCGTTTTTAAAATTAATCA TTATGATGGATCGTAGTGGAAATGATATTAATATGACTGGAGACAGTGAT CTAGATGATGATGGTTGTTTGTCTTCTGATGACTGTGATGGAGACTCTAA CCAGAGTAAAAGTGATTTAATGTCTGCAGCAATGGGAGATGATGTTACTG CACAGCTTGCTGCAGCAGGTTAGCTCAACGTTTTATTATTTTTTGTGTTC TAACAATTGGCACTTTTTATTTTTACTATTATTATTTATTATTATCCACT GCTTTTTTTTAACATAGAGGATCTTGTTAAACAATACTTGATAATATAAC TATAAAAATAATGAAAACAGTAGACATTTATTTTATGTTGTTTCTATATT TTAATAGTTTTGACTATATATTATTTTTAGTTTAAATATTAAAAAAAAAA AAAAATGGTTTAATTTTGTAATTATGCATGTTTTGTCTTTATTTTGTTTT GCACAATTTTTTTTTTTTGTTTTGCGTGTGTGTGTTTGTGTTTGGCTGGT AGAAAAACGCAATAGCGGATCGTCGAACACTAGGGGTCTTTGTTATGGTT TGTGTCGATCAGGACCAGTTGGAATGGCTGCTGCTGCTGCAATTGTGTCA TCAAAAAAGAGAAAAAGACCACATTCATTTGAGACCAATCCATCAATTCG AAAACGACAGCACAATCGGTTACTACGTAAACTCAAAGTGAGTTTTTAGT ATTCGAACATACAAATGTATTGTATACAATTTAAATTTCGAATTCAAGGT TACCATTGATGAGTTTGCTACCAGAGTTGGTCAACAAGCAATCGTATTAG TGGCAACACCTGGGAAAGAAACCACAGGTTTTAAATGCTTTGGTGCAAAA CCTTTAGAAGATGTTGTAAGTACATTTAGATTTATAATATAGAATATTAA AATTAATATCACAAATTCATTATTAAGGTAAAAAATTTACGTGCCACTAT TATGGACCAACTGGATACTGCATTAGCACAACATGCACCACCACCTATTC CAGATGACCCTACTCTATATGAGCTACCACCACTCATTTTAGATGGAATT CCAACTCCTGTTGAAAAAATGACCCAGGCTCAATTAAGAGCTTTTATACC TTTAATGTTGAAGTATTCCACAGGTAAGAGTAATTGGATATTTAAGTTAT ATAATAAATTTCACATAATAATGAAAATCAGATGTGATGTTAGAACTTTG AAAAATAAAAACTTATTCCCACATGTTTCATATGAATATCATACAAATAT ATTTTGATATTAGATAGTATTTTTAAATTTACTTTCATGAACACAATACT ACTGAAGTTTTTATTTTACTTCAGCTAAATTTACAATTATGATTTAAACA ATTTGAAATAGTATTATCGAAGCCGGATTAAGACTATAAGATCAACAACC AAATTTAAATTTACTTATAAATTWAAAAAAAAATTGAATATCAGTACCTA TACAGTTTTTTTTTWAAATATAGCAATAACTTACAGATTTTTATTAGTTT AATTAAATTTTTTTTTCTGCAATATTTATCCATAATTATTTTATTTATTA GGTAGAGGGAAACCTGGTTGGGGCAGAGAAAGTACCAGGCCACCTTGGTG GCCCAATGAATTACCTTGGGCAAATGTTAGAATGGATGCTCGATGTGAGG ATGAGAAACAAAAAGTAAGTACTTAACTATTATTAAAAATGTTCGATTAT TTTTGTCATTATTTATTATATTAACAGATTTCTTGGACAAGAGCATTACG ACAGATTGTTATAAACTGTTATAAATACCATGGTCGAGAAGATTTATTGC CTACATTTAGCGAAGAAGATGAGGCAAAAACAATTGTTAATAATGTTGCA AGTCAATCTATCGTTACTTCTGTGCTCAAATTCAATCCTAAAGCAACTAG TATTGAAGCTCGAAGTTCACCAGATGCACAGGAACAACAACAACAACAAC AACAACAACAACAACAACAACTAACCCAGGTTTGATTTGAAATATATTAA AATGAAATTAAAAAAATATTTACAACGAATATTTTAAAAGGTACAGTATT CTCCGGCATTCCTCCATTCTATTAGTAATGTTGATGGGTCAATGTCCATA TTTCATGTTGATCCAAATAACCCAATTATTACGTTACCTGATGGAACACA GGCCCATGTTCAAGGAGTTGTAAGTATTGTTTTGGTGGATTAAAAATTAG TTACAAAATATTCATTATAAATATATATTTTTTTTTTGTGCATAGATAAA TGCTTCCCAAGGACCAAATGGGCACACAGTTCATTCTGTTCATACCCTTG GTGAAGGCCAAAATCAAGATGGTGTAACTGTAGATATATTAAATAATGTA CCTGAAGCCACATTAAATCAAGAAGGTCAAATAATTATTACTGGTGAAGA TGGACAAGGTAAATATGCTTATATGTTTTTAAGGAAATTTAATTAAAATA ATTTTTATCTTTGAACAATTCTATTAATTTATGACGTAAAGTAATGTTAA AAAATTACTTCTTTCTCTCATGGTTTAGCTTGATACTATTGAGCCTTTCA GTAAGGTTATTGCCCAATAATCCAAATTAGATATTTTGTTCTTATGTTGG CTTTGTTTAGAGGACATCACACCCGCATGAGAAAAAATCTCACTTCTAAT AGTCAGTTTTTTTTTTTTACAATTTAAAAGATGAACTCTTAAATTATAAA TATAACTTTAACTATGYATGTTAAATTGGACTCAAATTTAAAAAATATAT CTATAGTTTTTARATCTATTAATATATGTAATATTCGTTAATTCGTTATA TGTCATGCATTTGTTATTAATTTTTTTCCCGGCATTATTTAAAGTTCTAT GAGATTTAATTATTATCATTTTAAAGTCAATTTTAATTGTTGAAATTGTA TTATTTTATTTTTCCATTTGGCTTATTGTATGACCACTGTACTATATCTA TATAAATTTCACGAATTTTTGCCCCGTAACTCATTAACTGCGTCAGGGGT ATAATTAAGGGTAGGTATGAGAAAGGAGAGATCTCTCAAAGCCTTTATAA TATAATATATGTATTCCCTATTAAAACTCGCTACTGTACTTAAAAATTTA AAATTTAATGCCAAATGGCTTCAAACTCGTTGCTGATTGATCCTCATGAC TCCAACTAACTCTAAATAGCCTGCTCCAACAGCCTTAATGTCTTAATAAA TAAAAATTAATACTCAGTATTTGTAAAACTACTATTTATATTATTTAATG ATTATTTAATAATATGTACAGTGTTGTATTTTCAGTATCAAGCATGATAA CAGTCCCTGTAAGTACTTCATTATACCAAAGTGTTTGTCAACAAATAAGT GAAGGTAGCATACAGGTACAGTTTCCTAGCCTACAGATTAAATGTGTAAA TGATAATCTACTACAATTATTATTATTTTCAGGTTGTCACCCCGGTTATG CATCATATGCCTAAGTCTGAGCCCGGTGGTGGGATGGATTCATCAAATTG TGAAGTGGAAACCATTAATGTGCCACATCAGTTGGTAGCCATCACCGGGC AAAATGGCGAACAAGTGTTGCAGTTGATTTCATTAAAAGATAATAAACTG ATCAATGCTACAGTTGGCGATATTAAAGAAGAAGGCACTAACATGTCTAA TTCAGACCAATGAGAACAACTTCAACATTACCTGTGCTTTGATGACCTTG GCAAATAAATTTTAAATAATATAGGGTAATGACTATCGGTATTTTTACTT CTTAAATGTATTATATATCTGTGTGCATGTGATTTAATAATGGTTATATA TATATATATATATATATACCTTTTTGTTCTGCCCTCAAACATGTGTATAA ATATAATATAATATATATTTTTATCACTTCCATATGATTCAGATAATTTA CTCTTCTAAAACTTAGAGTAAATCATCTTTTCTATACAAATTTTAAATAT TATAATATCGTAATTTTGTTCTTGGTTTAAACTTTCWTAGAAGTTTTTAT TATACATTACTCTAGTGTTTGGGATTTTCTAATTGTAGAAAAATAAGAGT TAATAAAAAAATACAGTGAAATACTATTTTAAGCCTAATTAAATTAGCCT GATTTAATTGATTATTATTTACCATTTTGGAACTTTTAGTCTTTTAAGTT TAAAAAAGTCATACATTTTTGTGTGGCCATGACTCTAAACCTAGTCAATA TGTTAGTCCTGTAAACAATATTACAGAAGTTTAAGTTTTTGTTTATTTGT TTAAGATAAATATTCTCGCCCTAGATTTTTAGATGTTTTTATTTTTATGT GGGTTGTATTTTCTTGTAAACTGTTTTTTCCATGTTATTTGTCACGTTCA CAGACATTAATGTTAGAAAAAGTGCAATTCTGTAAAAAAAAATTAATACC ATTTTTGAATGTAATTTTTTTGTTTCCACATTGTTGATATTGTTTATTTG AGTGTCCTTGCCTGATATATATGTATACATATATATATATATCAAATGTT CATGTATTTRTCTATTATATTATATCAATGTAAATATATACTATGTATAA TATATGACTTTTTATTAAGTTAGCTTGTTTTCTCTTTTTTTATTATTTAA TTGTGTACATTTTGTAATCAATTCAATGTGAAATCTTCATACTCAAATTT TCTGATTACTTATTTTATTATTTATTTTAGGTTATTAGATAATGTTATAC AATACTATGTACCTATTGAATTAGATAATTGTTGTGTGCTGTTATCAAAC ATGAAACGGGACATTTATTATTATC
back to top

Coding sequence (CDS) from alignment at JOTR01000065:113911..123385-

>rna3626 ID=rna3626|Name=XM_015507620.1|organism=Diuraphis noxia|type=CDS|length=1572bp|location=Sequence derived from alignment at JOTR01000065:113911..123385- (Diuraphis noxia)
ATGATGGATCGTAGTGGAAATGATATTAATATGACTGGAGACAGTGATCT
AGATGATGATGGTTGTTTGTCTTCTGATGACTGTGATGGAGACTCTAACC
AGAGTAAAAGTGATTTAATGTCTGCAGCAATGGGAGATGATGTTACTGCA
CAGCTTGCTGCAGCAGGACCAGTTGGAATGGCTGCTGCTGCTGCAATTGT
GTCATCAAAAAAGAGAAAAAGACCACATTCATTTGAGACCAATCCATCAA
TTCGAAAACGACAGCACAATCGGTTACTACGTAAACTCAAAGTTACCATT
GATGAGTTTGCTACCAGAGTTGGTCAACAAGCAATCGTATTAGTGGCAAC
ACCTGGGAAAGAAACCACAGGTTTTAAATGCTTTGGTGCAAAACCTTTAG
AAGATGTTGTAAAAAATTTACGTGCCACTATTATGGACCAACTGGATACT
GCATTAGCACAACATGCACCACCACCTATTCCAGATGACCCTACTCTATA
TGAGCTACCACCACTCATTTTAGATGGAATTCCAACTCCTGTTGAAAAAA
TGACCCAGGCTCAATTAAGAGCTTTTATACCTTTAATGTTGAAGTATTCC
ACAGGTAGAGGGAAACCTGGTTGGGGCAGAGAAAGTACCAGGCCACCTTG
GTGGCCCAATGAATTACCTTGGGCAAATGTTAGAATGGATGCTCGATGTG
AGGATGAGAAACAAAAAATTTCTTGGACAAGAGCATTACGACAGATTGTT
ATAAACTGTTATAAATACCATGGTCGAGAAGATTTATTGCCTACATTTAG
CGAAGAAGATGAGGCAAAAACAATTGTTAATAATGTTGCAAGTCAATCTA
TCGTTACTTCTGTGCTCAAATTCAATCCTAAAGCAACTAGTATTGAAGCT
CGAAGTTCACCAGATGCACAGGAACAACAACAACAACAACAACAACAACA
ACAACAACAACTAACCCAGGTACAGTATTCTCCGGCATTCCTCCATTCTA
TTAGTAATGTTGATGGGTCAATGTCCATATTTCATGTTGATCCAAATAAC
CCAATTATTACGTTACCTGATGGAACACAGGCCCATGTTCAAGGAGTTAT
AAATGCTTCCCAAGGACCAAATGGGCACACAGTTCATTCTGTTCATACCC
TTGGTGAAGGCCAAAATCAAGATGGTGTAACTGTAGATATATTAAATAAT
GTACCTGAAGCCACATTAAATCAAGAAGGTCAAATAATTATTACTGGTGA
AGATGGACAAGTATCAAGCATGATAACAGTCCCTGTAAGTACTTCATTAT
ACCAAAGTGTTTGTCAACAAATAAGTGAAGGTAGCATACAGGTTGTCACC
CCGGTTATGCATCATATGCCTAAGTCTGAGCCCGGTGGTGGGATGGATTC
ATCAAATTGTGAAGTGGAAACCATTAATGTGCCACATCAGTTGGTAGCCA
TCACCGGGCAAAATGGCGAACAAGTGTTGCAGTTGATTTCATTAAAAGAT
AATAAACTGATCAATGCTACAGTTGGCGATATTAAAGAAGAAGGCACTAA
CATGTCTAATTCAGACCAATGA
back to top