rna3628 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507618.1
Unique Namerna3628
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:113911..123385 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507618.1
ProductDNA-binding protein Ewg-like, transcript variant X1
Model evidenceSupporting evidence includes similarity to: 2 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161277
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507618.1
GeneID107161277
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161277gene2456Diuraphis noxiageneJOTR01000065 113911..123385 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507618.1rna3628Diuraphis noxiapolypeptideJOTR01000065 115023..118683 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363104.1cds3532Diuraphis noxiaCDSJOTR01000065 115023..115253 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31706id31706Diuraphis noxiaexonJOTR01000065 113911..115253 -
id31705id31705Diuraphis noxiaexonJOTR01000065 115321..115400 -
id31704id31704Diuraphis noxiaexonJOTR01000065 116278..116440 -
id31703id31703Diuraphis noxiaexonJOTR01000065 116517..116645 -
id31702id31702Diuraphis noxiaexonJOTR01000065 116707..116958 -
id31701id31701Diuraphis noxiaexonJOTR01000065 117022..117134 -
id31700id31700Diuraphis noxiaexonJOTR01000065 117563..117758 -
id31699id31699Diuraphis noxiaexonJOTR01000065 117821..117937 -
id31698id31698Diuraphis noxiaexonJOTR01000065 117999..118183 -
id31697id31697Diuraphis noxiaexonJOTR01000065 118518..118705 -
id31696id31696Diuraphis noxiaexonJOTR01000065 118776..118882 -
id31695id31695Diuraphis noxiaexonJOTR01000065 123298..123385 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3628 ID=rna3628|Name=XM_015507618.1|organism=Diuraphis noxia|type=mRNA|length=2961bp|location=Sequence derived from alignment at JOTR01000065:113911..123385- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
GGGCGATGGACTCGGCCAACACGGGCACTGCCGCCGCCGCCGTCGACGCC
GACGCCGACGCCGCAGCCGCCGTTCTCCCGTCACGCAGATTATTCAACWT
GGATTTCAATCAGAAATTATATTTTATCGGGAATTAAAATTGTTCAATAT
TGAAGATTTCAATTGAGTATTTGACTGAATTTTTAAACTTGTGAGGTCGT
TTTTAAAATTAATCATTATGATGGATCGTAGTGGAAATGATATTAATATG
ACTGGAGACAGTGATCTAGATGATGATGGTTGTTTGTCTTCTGATGACTG
TGATGGAGACTCTAACCAGAGTAAAAGTGATTTAATGTCTGCAGCAATGG
GAGATGATGTTACTGCACAGCTTGCTGCAGCAGAAAAACGCAATAGCGGA
TCGTCGAACACTAGGGGTCTTTGTTATGGTTTGTGTCGATCAGGACCAGT
TGGAATGGCTGCTGCTGCTGCAATTGTGTCATCAAAAAAGAGAAAAAGAC
CACATTCATTTGAGACCAATCCATCAATTCGAAAACGACAGCACAATCGG
TTACTACGTAAACTCAAAGTTACCATTGATGAGTTTGCTACCAGAGTTGG
TCAACAAGCAATCGTATTAGTGGCAACACCTGGGAAAGAAACCACAGGTT
TTAAATGCTTTGGTGCAAAACCTTTAGAAGATGTTGTAAAAAATTTACGT
GCCACTATTATGGACCAACTGGATACTGCATTAGCACAACATGCACCACC
ACCTATTCCAGATGACCCTACTCTATATGAGCTACCACCACTCATTTTAG
ATGGAATTCCAACTCCTGTTGAAAAAATGACCCAGGCTCAATTAAGAGCT
TTTATACCTTTAATGTTGAAGTATTCCACAGGTAGAGGGAAACCTGGTTG
GGGCAGAGAAAGTACCAGGCCACCTTGGTGGCCCAATGAATTACCTTGGG
CAAATGTTAGAATGGATGCTCGATGTGAGGATGAGAAACAAAAAATTTCT
TGGACAAGAGCATTACGACAGATTGTTATAAACTGTTATAAATACCATGG
TCGAGAAGATTTATTGCCTACATTTAGCGAAGAAGATGAGGCAAAAACAA
TTGTTAATAATGTTGCAAGTCAATCTATCGTTACTTCTGTGCTCAAATTC
AATCCTAAAGCAACTAGTATTGAAGCTCGAAGTTCACCAGATGCACAGGA
ACAACAACAACAACAACAACAACAACAACAACAACAACTAACCCAGGTAC
AGTATTCTCCGGCATTCCTCCATTCTATTAGTAATGTTGATGGGTCAATG
TCCATATTTCATGTTGATCCAAATAACCCAATTATTACGTTACCTGATGG
AACACAGGCCCATGTTCAAGGAGTTATAAATGCTTCCCAAGGACCAAATG
GGCACACAGTTCATTCTGTTCATACCCTTGGTGAAGGCCAAAATCAAGAT
GGTGTAACTGTAGATATATTAAATAATGTACCTGAAGCCACATTAAATCA
AGAAGGTCAAATAATTATTACTGGTGAAGATGGACAAGTATCAAGCATGA
TAACAGTCCCTGTAAGTACTTCATTATACCAAAGTGTTTGTCAACAAATA
AGTGAAGGTAGCATACAGGTTGTCACCCCGGTTATGCATCATATGCCTAA
GTCTGAGCCCGGTGGTGGGATGGATTCATCAAATTGTGAAGTGGAAACCA
TTAATGTGCCACATCAGTTGGTAGCCATCACCGGGCAAAATGGCGAACAA
GTGTTGCAGTTGATTTCATTAAAAGATAATAAACTGATCAATGCTACAGT
TGGCGATATTAAAGAAGAAGGCACTAACATGTCTAATTCAGACCAATGAG
AACAACTTCAACATTACCTGTGCTTTGATGACCTTGGCAAATAAATTTTA
AATAATATAGGGTAATGACTATCGGTATTTTTACTTCTTAAATGTATTAT
ATATCTGTGTGCATGTGATTTAATAATGGTTATATATATATATATATATA
TATACCTTTTTGTTCTGCCCTCAAACATGTGTATAAATATAATATAATAT
ATATTTTTATCACTTCCATATGATTCAGATAATTTACTCTTCTAAAACTT
AGAGTAAATCATCTTTTCTATACAAATTTTAAATATTATAATATCGTAAT
TTTGTTCTTGGTTTAAACTTTCWTAGAAGTTTTTATTATACATTACTCTA
GTGTTTGGGATTTTCTAATTGTAGAAAAATAAGAGTTAATAAAAAAATAC
AGTGAAATACTATTTTAAGCCTAATTAAATTAGCCTGATTTAATTGATTA
TTATTTACCATTTTGGAACTTTTAGTCTTTTAAGTTTAAAAAAGTCATAC
ATTTTTGTGTGGCCATGACTCTAAACCTAGTCAATATGTTAGTCCTGTAA
ACAATATTACAGAAGTTTAAGTTTTTGTTTATTTGTTTAAGATAAATATT
CTCGCCCTAGATTTTTAGATGTTTTTATTTTTATGTGGGTTGTATTTTCT
TGTAAACTGTTTTTTCCATGTTATTTGTCACGTTCACAGACATTAATGTT
AGAAAAAGTGCAATTCTGTAAAAAAAAATTAATACCATTTTTGAATGTAA
TTTTTTTGTTTCCACATTGTTGATATTGTTTATTTGAGTGTCCTTGCCTG
ATATATATGTATACATATATATATATATCAAATGTTCATGTATTTRTCTA
TTATATTATATCAATGTAAATATATACTATGTATAATATATGACTTTTTA
TTAAGTTAGCTTGTTTTCTCTTTTTTTATTATTTAATTGTGTACATTTTG
TAATCAATTCAATGTGAAATCTTCATACTCAAATTTTCTGATTACTTATT
TTATTATTTATTTTAGGTTATTAGATAATGTTATACAATACTATGTACCT
ATTGAATTAGATAATTGTTGTGTGCTGTTATCAAACATGAAACGGGACAT
TTATTATTATC
back to top

protein sequence of XM_015507618.1

>rna3628 ID=rna3628|Name=XM_015507618.1|organism=Diuraphis noxia|type=polypeptide|length=544bp
MMDRSGNDINMTGDSDLDDDGCLSSDDCDGDSNQSKSDLMSAAMGDDVTA
QLAAAEKRNSGSSNTRGLCYGLCRSGPVGMAAAAAIVSSKKRKRPHSFET
NPSIRKRQHNRLLRKLKVTIDEFATRVGQQAIVLVATPGKETTGFKCFGA
KPLEDVVKNLRATIMDQLDTALAQHAPPPIPDDPTLYELPPLILDGIPTP
VEKMTQAQLRAFIPLMLKYSTGRGKPGWGRESTRPPWWPNELPWANVRMD
ARCEDEKQKISWTRALRQIVINCYKYHGREDLLPTFSEEDEAKTIVNNVA
SQSIVTSVLKFNPKATSIEARSSPDAQEQQQQQQQQQQQQLTQVQYSPAF
LHSISNVDGSMSIFHVDPNNPIITLPDGTQAHVQGVINASQGPNGHTVHS
VHTLGEGQNQDGVTVDILNNVPEATLNQEGQIIITGEDGQVSSMITVPVS
TSLYQSVCQQISEGSIQVVTPVMHHMPKSEPGGGMDSSNCEVETINVPHQ
LVAITGQNGEQVLQLISLKDNKLINATVGDIKEEGTNMSNSDQ.
back to top

mRNA from alignment at JOTR01000065:113911..123385-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3628 ID=rna3628|Name=XM_015507618.1|organism=Diuraphis noxia|type=mRNA|length=9475bp|location=Sequence derived from alignment at JOTR01000065:113911..123385- (Diuraphis noxia)
GGGCGATGGACTCGGCCAACACGGGCACTGCCGCCGCCGCCGTCGACGCC GACGCCGACGCCGCAGCCGCCGTTCTCCCGTCACGCAGGTGCGTACGCAG CCGTACTCTGGTAATATTCATTAACGTCACCATCGGTGTGTCGCGTCGAT TCTTTTACGCCATATCATGCGTGCTGCCAATTAGGGCTTTTTTCTTTTTT TTTCTTTACCTCGGCCTGCCCGCGAAACGTCTCKTCACCCACGGCGATGA TTGCCGCTTCGGYGGAGGACCCCCCTGAGCTGGCGTTCGGTCCGGGCTCG ACCGTTTTGTTTTTCGATACACCTTCTCGCGTAATCCAATCGAAGCGGCA CACACGAACAACACGTCATGACACACACTGCGGCTGCGGCGGCGGCGGCG GTGCTTCTATAGGAACTAGGAAGTCCGTCGACGCCGACGCCGCGGTGACG ACGTTGTTGCTGCGCCTTAGGAGTTGCGCCCGGCATAATATTATTATTAT TATAATGTATGCCGTCGAGCTCCGCGACAGTAGTAGTAGTAGTAGTAGTA GTAATAGTAATAGTAGTAGTATATTAGTAATAGTAACAACTAGTAATTGT AGGCAACAATACCGTGTCGGAGACTTGTAGTAGATTCGAGGTGATATTAA CCTGAAAATAATTTGTTTTATTAGGAGCACCGCGATTGGTAGTTGGCACG CATTGTTGATTTTCCACACTGTTGAGCCTAATCTAATACTTTGCCAAATT TACAATTTCTTCTAGGTCTCTMAAATTTTCGGCTCACTGTATTACGTTAC CCCCCTCCGAAGATTATGTCGTTGTGAAACTTGATTATGCACGTCAAGTG AATAAACGGAAAAAATGTTTCGAGCACCCATACTTGATGTGCACGAGATA TGAGCTTTTTGGATTTTTTCTCCTATTTGGTTTTTACGATTTCATTCGTT TTTATCATATCGCATTTCCTTCGTTGTGGGAACGGACATTATCTAATATT AACGTTATTATGACATTTTACACGTCGTCTGGTTTCCATTGTCACTATCA ATCGCGCATATCGTTGTTTACTCCGTTATCTCAGAAATTCTCACACCCAA CAACAATGTACATGTTGACGGCATCTAAAACGTTAAAATTTCACTCATGT ACATGTTGCTCTTATGAGTTAGTATAAAACATTTTGATTACTGATTAATA TATGTCGCGACGTCCAAACTTATGTGTATAATATATAATATTATTTATAT CCATCAAAGTACATTAACATTTCGATCAAAAAATACTCTAACGTATCTTC GAGAGAATGTATTGTTTTGTTATCGGTTGTTCCTAACATTTATCTACATT CTACAATAATAGTTAGTTATTGGTTTCGAACTAACAGCATTTCTGGATAT CATCCGCCGTTATCTCATGGAAGTTATAATTATATTATACTCGTGTGGTG ATGCATAATGCATTACGAAATGTTCAAAATTATTTAAATTCAAGTTGACG GATAAAAATAATATTATCTTCATTCGTTTTAGTGGCTATATTATATTTAA TCAATTTTGAAAATTGACTACATTCGTGGCCATGAATAAAACATCAAATT ATTACTGTTAGGGATACCTTTATAGTTCATTTTATGCGTGAATATGATTT AAATAGATATTAAAACAGTTATGACAGTTTATAAGTTTTATTAATATTAC TTATTATAATGGGACTGTGGTAGAATAAAGAAGTCGTTTAGTCGTATATT ATTCATAATGTAAACAATAATTTTACCAGTGAATGTTTTTGTTTCGTGAA CTTACCGGTAGATCACGCTGCAGTCTTTTGGCTCTAGTTTTCATACTTAC ATGTAAATTGCATACAATAAATGAAGACATATTGTAATACATCAATACAA TATGTATTATAACGACATTATGMTAACTAAAAATCAACATTTATTATATT AATATTGGTTAGGTCAGTTAAAATAAAATAATTTTTTTATTAATTAATAG GTACATAACTTTAAAATATTTGAAAACTAAGTACCTACCTTAAACATTAT TTTAACTCTTCTTTTTTTCCCTGGATATTTTTTTGGATGATCAATCTTGT TTTCTTGTATTCTCTCATTCTTATATACATGTAATAATGCAAACAACTTG TCATCACACTACTCTAGCATTAATGAATTTTTTGAATTGTGGACACATAT CATCTCTTTTTTATTATTTTTGGTACAGATGAAAARGYCYTYYKGGRAWW WTTWAAAAAAAAWTTTATCTATTATKATTATTAAATACTTTTATTTGCAA GTTTCTTTCTCTCTGTAGAAGTTCAAAACCATATGGTTTCTTCTTCTTTG AAGTGTATTGTACAAACAAATGAATTTATGCTTAGTTCTATAACCCTCTT TGGTATAGCTTTTTTCCACACATCAAAATCTAATTGTTTWGCAGCAGCTT TAAACATTGAAACCTAATATGGTAAATTATATCATAGAACTTTAAAGCAA ATATAAACAGTGCTTGAATTGGTGAGGATAAGTCTTTTTCGAGAAATATT TTGGTATACACTTTAAATATATTTCAGTCAGTAAATACCGGTTACTTCAG TTTTCACTTTTGCATCACCTTGGCAATTTTTTAAAATCAGAACTCTAAAG GACGTGTTTAATAATTATAATCACAAAATTTATCCATTTTTTATTTCAAT AATCAATTTACTTTATTCTTACAAATTACATAGGTAACCGGATTTTCAAT GTACTTCATAACACTTAACCATTTTAAATAAAAACAATTGTTAAGTATTT AAATAAATTAAGAATCATATAAATGTTTGTGACATTGTGTGAATATTCTA YTTCACAACTATAATAAATTACCTGTTATTTATGAGTAAACAAAAATGAC AATTTTTATAAAGCCGAACGTTTGCAGGGTCGCTCAGTTCAGCTAGTTTT TAGTTTATTTCATCATGGTGAAAATCGTACAACAAAATAAAGTATAATAC TATAATATCATAGATAATATATAATATATGTATATAATATAATTATTATT ATAAGTTATAATATTATAAATAATCATTTTAGTTATTACTAAACAACTGT TACGCGATCTAGTGGTGAATTCTTCTTAAATATATACTTCTAAAACATGA TTTTGATAGTTATGCGAATAACTCTATTATCTACCATGCTTATAATTTAT AATATTATACACAATATGATTAAATATTTAGTCATGATTATACCACAGAT TATATAAATATATATTTATATGTTTTATATAATCTGTGATTATACCTAAA CTTAAATATTGATAACATACTTATTTGCTCTAACTATCGCCAATTCAGTA ATTCCCTTATATTATCTATGCTTAAAACTGTTACACATTTKATGATAATA AATTACTTCTATAACTACCTTCTTAAAGTATTTCAGTAGTTGTTAAATAC ATTTTAAAACTATTAAAATTACGAAGAGTTCAGACTTGGGTACTCRGATA TTTTGTTTTGTTGTACAACAAATTGTTTACTCATTAAACTTGTTATCAGA TYAAAAATACTATTGATATCCCGTTAGTCTAATATCCTTAGTTGGGTTGT AGATAAGAAAAATTGGGATTAAATATTTTAATCTACAATAGATGTTATCT TTTAGTTGCTATTAATTTTTGACTATAATATGATAATTTTTGTATTTTGG ATATTAGATATCGATATAAAATGATTTCGTTCTTGTTTTACATTTCATTC TGTGTTGTATTTTATACTATTAATGTTTCGGAGTAAAATGTTAAATTTGT AGATAAATTGTTAATTTTGTTAACTAATATATAATTTTTAAATTAATGAA CCATTARTAATATATACACACAACCATCTAATTTATCACCATGATTTTTA TGGTTATTTTTGTTTTATTATATGAGTGGGTAAGCAAATATTATAGTTTT TTATTTCACTCACCTATATTATTTTTAAAGATGAATTTTGTAACATCATT TAACAAAAATGTCTTAAATGTTACTACTTAAATTATTCAGGCAATGATAT TTTTTAACCTAACAATTGATCTACATTATTTAGAGTATTCAAAAATTTTA TTTAATATTTTAGGAATACAAATTAGATCATCTAGAAACGTGTAAAATTA TGTTAATTTGTTTAAATATTGAAGTAGACTATGACTCATTTGACATATTA TGTATATTATGTGATTTTACTATAGTTCATAATTGTGGTATCTACATAGG CGTAATTTGGGTTAGATTTATGGCGGTGCTAGATTTAAGTTGACCAAAGT CATAAATTTATCTCCTAATGCCTATGACATAAAATCATAAGTTATAAGTT TATAACCAATAACAATTTGGGAGTGCTATGCACCCTCAAGCACCCTCAAA ATTGCGCCTATGGTACCTATCTATTTCATACAGATTATTGATTTATATAT GAAATTCATAAGTAATTCATAATTTACGATTTATTAATATTTTTATTTTA TAGATTATTCAACWTGGATTTCAATCAGAAATTATATTTTATCGGGAATT AAAATTGTTCAATATTGAAGATTTCAATTGAGTATTTGACTGAATTTTTA AACTTGTGAGGTATAAAAATTTATAAAAATTTGTTTGAGTTATTAATCAA TAATTTACCTATAAAAAATTTAATTTATAGGTCGTTTTTAAAATTAATCA TTATGATGGATCGTAGTGGAAATGATATTAATATGACTGGAGACAGTGAT CTAGATGATGATGGTTGTTTGTCTTCTGATGACTGTGATGGAGACTCTAA CCAGAGTAAAAGTGATTTAATGTCTGCAGCAATGGGAGATGATGTTACTG CACAGCTTGCTGCAGCAGGTTAGCTCAACGTTTTATTATTTTTTGTGTTC TAACAATTGGCACTTTTTATTTTTACTATTATTATTTATTATTATCCACT GCTTTTTTTTAACATAGAGGATCTTGTTAAACAATACTTGATAATATAAC TATAAAAATAATGAAAACAGTAGACATTTATTTTATGTTGTTTCTATATT TTAATAGTTTTGACTATATATTATTTTTAGTTTAAATATTAAAAAAAAAA AAAAATGGTTTAATTTTGTAATTATGCATGTTTTGTCTTTATTTTGTTTT GCACAATTTTTTTTTTTTGTTTTGCGTGTGTGTGTTTGTGTTTGGCTGGT AGAAAAACGCAATAGCGGATCGTCGAACACTAGGGGTCTTTGTTATGGTT TGTGTCGATCAGGACCAGTTGGAATGGCTGCTGCTGCTGCAATTGTGTCA TCAAAAAAGAGAAAAAGACCACATTCATTTGAGACCAATCCATCAATTCG AAAACGACAGCACAATCGGTTACTACGTAAACTCAAAGTGAGTTTTTAGT ATTCGAACATACAAATGTATTGTATACAATTTAAATTTCGAATTCAAGGT TACCATTGATGAGTTTGCTACCAGAGTTGGTCAACAAGCAATCGTATTAG TGGCAACACCTGGGAAAGAAACCACAGGTTTTAAATGCTTTGGTGCAAAA CCTTTAGAAGATGTTGTAAGTACATTTAGATTTATAATATAGAATATTAA AATTAATATCACAAATTCATTATTAAGGTAAAAAATTTACGTGCCACTAT TATGGACCAACTGGATACTGCATTAGCACAACATGCACCACCACCTATTC CAGATGACCCTACTCTATATGAGCTACCACCACTCATTTTAGATGGAATT CCAACTCCTGTTGAAAAAATGACCCAGGCTCAATTAAGAGCTTTTATACC TTTAATGTTGAAGTATTCCACAGGTAAGAGTAATTGGATATTTAAGTTAT ATAATAAATTTCACATAATAATGAAAATCAGATGTGATGTTAGAACTTTG AAAAATAAAAACTTATTCCCACATGTTTCATATGAATATCATACAAATAT ATTTTGATATTAGATAGTATTTTTAAATTTACTTTCATGAACACAATACT ACTGAAGTTTTTATTTTACTTCAGCTAAATTTACAATTATGATTTAAACA ATTTGAAATAGTATTATCGAAGCCGGATTAAGACTATAAGATCAACAACC AAATTTAAATTTACTTATAAATTWAAAAAAAAATTGAATATCAGTACCTA TACAGTTTTTTTTTWAAATATAGCAATAACTTACAGATTTTTATTAGTTT AATTAAATTTTTTTTTCTGCAATATTTATCCATAATTATTTTATTTATTA GGTAGAGGGAAACCTGGTTGGGGCAGAGAAAGTACCAGGCCACCTTGGTG GCCCAATGAATTACCTTGGGCAAATGTTAGAATGGATGCTCGATGTGAGG ATGAGAAACAAAAAGTAAGTACTTAACTATTATTAAAAATGTTCGATTAT TTTTGTCATTATTTATTATATTAACAGATTTCTTGGACAAGAGCATTACG ACAGATTGTTATAAACTGTTATAAATACCATGGTCGAGAAGATTTATTGC CTACATTTAGCGAAGAAGATGAGGCAAAAACAATTGTTAATAATGTTGCA AGTCAATCTATCGTTACTTCTGTGCTCAAATTCAATCCTAAAGCAACTAG TATTGAAGCTCGAAGTTCACCAGATGCACAGGAACAACAACAACAACAAC AACAACAACAACAACAACAACTAACCCAGGTTTGATTTGAAATATATTAA AATGAAATTAAAAAAATATTTACAACGAATATTTTAAAAGGTACAGTATT CTCCGGCATTCCTCCATTCTATTAGTAATGTTGATGGGTCAATGTCCATA TTTCATGTTGATCCAAATAACCCAATTATTACGTTACCTGATGGAACACA GGCCCATGTTCAAGGAGTTGTAAGTATTGTTTTGGTGGATTAAAAATTAG TTACAAAATATTCATTATAAATATATATTTTTTTTTTGTGCATAGATAAA TGCTTCCCAAGGACCAAATGGGCACACAGTTCATTCTGTTCATACCCTTG GTGAAGGCCAAAATCAAGATGGTGTAACTGTAGATATATTAAATAATGTA CCTGAAGCCACATTAAATCAAGAAGGTCAAATAATTATTACTGGTGAAGA TGGACAAGGTAAATATGCTTATATGTTTTTAAGGAAATTTAATTAAAATA ATTTTTATCTTTGAACAATTCTATTAATTTATGACGTAAAGTAATGTTAA AAAATTACTTCTTTCTCTCATGGTTTAGCTTGATACTATTGAGCCTTTCA GTAAGGTTATTGCCCAATAATCCAAATTAGATATTTTGTTCTTATGTTGG CTTTGTTTAGAGGACATCACACCCGCATGAGAAAAAATCTCACTTCTAAT AGTCAGTTTTTTTTTTTTACAATTTAAAAGATGAACTCTTAAATTATAAA TATAACTTTAACTATGYATGTTAAATTGGACTCAAATTTAAAAAATATAT CTATAGTTTTTARATCTATTAATATATGTAATATTCGTTAATTCGTTATA TGTCATGCATTTGTTATTAATTTTTTTCCCGGCATTATTTAAAGTTCTAT GAGATTTAATTATTATCATTTTAAAGTCAATTTTAATTGTTGAAATTGTA TTATTTTATTTTTCCATTTGGCTTATTGTATGACCACTGTACTATATCTA TATAAATTTCACGAATTTTTGCCCCGTAACTCATTAACTGCGTCAGGGGT ATAATTAAGGGTAGGTATGAGAAAGGAGAGATCTCTCAAAGCCTTTATAA TATAATATATGTATTCCCTATTAAAACTCGCTACTGTACTTAAAAATTTA AAATTTAATGCCAAATGGCTTCAAACTCGTTGCTGATTGATCCTCATGAC TCCAACTAACTCTAAATAGCCTGCTCCAACAGCCTTAATGTCTTAATAAA TAAAAATTAATACTCAGTATTTGTAAAACTACTATTTATATTATTTAATG ATTATTTAATAATATGTACAGTGTTGTATTTTCAGTATCAAGCATGATAA CAGTCCCTGTAAGTACTTCATTATACCAAAGTGTTTGTCAACAAATAAGT GAAGGTAGCATACAGGTACAGTTTCCTAGCCTACAGATTAAATGTGTAAA TGATAATCTACTACAATTATTATTATTTTCAGGTTGTCACCCCGGTTATG CATCATATGCCTAAGTCTGAGCCCGGTGGTGGGATGGATTCATCAAATTG TGAAGTGGAAACCATTAATGTGCCACATCAGTTGGTAGCCATCACCGGGC AAAATGGCGAACAAGTGTTGCAGTTGATTTCATTAAAAGATAATAAACTG ATCAATGCTACAGTTGGCGATATTAAAGAAGAAGGCACTAACATGTCTAA TTCAGACCAATGAGAACAACTTCAACATTACCTGTGCTTTGATGACCTTG GCAAATAAATTTTAAATAATATAGGGTAATGACTATCGGTATTTTTACTT CTTAAATGTATTATATATCTGTGTGCATGTGATTTAATAATGGTTATATA TATATATATATATATATACCTTTTTGTTCTGCCCTCAAACATGTGTATAA ATATAATATAATATATATTTTTATCACTTCCATATGATTCAGATAATTTA CTCTTCTAAAACTTAGAGTAAATCATCTTTTCTATACAAATTTTAAATAT TATAATATCGTAATTTTGTTCTTGGTTTAAACTTTCWTAGAAGTTTTTAT TATACATTACTCTAGTGTTTGGGATTTTCTAATTGTAGAAAAATAAGAGT TAATAAAAAAATACAGTGAAATACTATTTTAAGCCTAATTAAATTAGCCT GATTTAATTGATTATTATTTACCATTTTGGAACTTTTAGTCTTTTAAGTT TAAAAAAGTCATACATTTTTGTGTGGCCATGACTCTAAACCTAGTCAATA TGTTAGTCCTGTAAACAATATTACAGAAGTTTAAGTTTTTGTTTATTTGT TTAAGATAAATATTCTCGCCCTAGATTTTTAGATGTTTTTATTTTTATGT GGGTTGTATTTTCTTGTAAACTGTTTTTTCCATGTTATTTGTCACGTTCA CAGACATTAATGTTAGAAAAAGTGCAATTCTGTAAAAAAAAATTAATACC ATTTTTGAATGTAATTTTTTTGTTTCCACATTGTTGATATTGTTTATTTG AGTGTCCTTGCCTGATATATATGTATACATATATATATATATCAAATGTT CATGTATTTRTCTATTATATTATATCAATGTAAATATATACTATGTATAA TATATGACTTTTTATTAAGTTAGCTTGTTTTCTCTTTTTTTATTATTTAA TTGTGTACATTTTGTAATCAATTCAATGTGAAATCTTCATACTCAAATTT TCTGATTACTTATTTTATTATTTATTTTAGGTTATTAGATAATGTTATAC AATACTATGTACCTATTGAATTAGATAATTGTTGTGTGCTGTTATCAAAC ATGAAACGGGACATTTATTATTATC
back to top

Coding sequence (CDS) from alignment at JOTR01000065:113911..123385-

>rna3628 ID=rna3628|Name=XM_015507618.1|organism=Diuraphis noxia|type=CDS|length=1632bp|location=Sequence derived from alignment at JOTR01000065:113911..123385- (Diuraphis noxia)
ATGATGGATCGTAGTGGAAATGATATTAATATGACTGGAGACAGTGATCT
AGATGATGATGGTTGTTTGTCTTCTGATGACTGTGATGGAGACTCTAACC
AGAGTAAAAGTGATTTAATGTCTGCAGCAATGGGAGATGATGTTACTGCA
CAGCTTGCTGCAGCAGAAAAACGCAATAGCGGATCGTCGAACACTAGGGG
TCTTTGTTATGGTTTGTGTCGATCAGGACCAGTTGGAATGGCTGCTGCTG
CTGCAATTGTGTCATCAAAAAAGAGAAAAAGACCACATTCATTTGAGACC
AATCCATCAATTCGAAAACGACAGCACAATCGGTTACTACGTAAACTCAA
AGTTACCATTGATGAGTTTGCTACCAGAGTTGGTCAACAAGCAATCGTAT
TAGTGGCAACACCTGGGAAAGAAACCACAGGTTTTAAATGCTTTGGTGCA
AAACCTTTAGAAGATGTTGTAAAAAATTTACGTGCCACTATTATGGACCA
ACTGGATACTGCATTAGCACAACATGCACCACCACCTATTCCAGATGACC
CTACTCTATATGAGCTACCACCACTCATTTTAGATGGAATTCCAACTCCT
GTTGAAAAAATGACCCAGGCTCAATTAAGAGCTTTTATACCTTTAATGTT
GAAGTATTCCACAGGTAGAGGGAAACCTGGTTGGGGCAGAGAAAGTACCA
GGCCACCTTGGTGGCCCAATGAATTACCTTGGGCAAATGTTAGAATGGAT
GCTCGATGTGAGGATGAGAAACAAAAAATTTCTTGGACAAGAGCATTACG
ACAGATTGTTATAAACTGTTATAAATACCATGGTCGAGAAGATTTATTGC
CTACATTTAGCGAAGAAGATGAGGCAAAAACAATTGTTAATAATGTTGCA
AGTCAATCTATCGTTACTTCTGTGCTCAAATTCAATCCTAAAGCAACTAG
TATTGAAGCTCGAAGTTCACCAGATGCACAGGAACAACAACAACAACAAC
AACAACAACAACAACAACAACTAACCCAGGTACAGTATTCTCCGGCATTC
CTCCATTCTATTAGTAATGTTGATGGGTCAATGTCCATATTTCATGTTGA
TCCAAATAACCCAATTATTACGTTACCTGATGGAACACAGGCCCATGTTC
AAGGAGTTATAAATGCTTCCCAAGGACCAAATGGGCACACAGTTCATTCT
GTTCATACCCTTGGTGAAGGCCAAAATCAAGATGGTGTAACTGTAGATAT
ATTAAATAATGTACCTGAAGCCACATTAAATCAAGAAGGTCAAATAATTA
TTACTGGTGAAGATGGACAAGTATCAAGCATGATAACAGTCCCTGTAAGT
ACTTCATTATACCAAAGTGTTTGTCAACAAATAAGTGAAGGTAGCATACA
GGTTGTCACCCCGGTTATGCATCATATGCCTAAGTCTGAGCCCGGTGGTG
GGATGGATTCATCAAATTGTGAAGTGGAAACCATTAATGTGCCACATCAG
TTGGTAGCCATCACCGGGCAAAATGGCGAACAAGTGTTGCAGTTGATTTC
ATTAAAAGATAATAAACTGATCAATGCTACAGTTGGCGATATTAAAGAAG
AAGGCACTAACATGTCTAATTCAGACCAATGA
back to top