rna3632 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507624.1
Unique Namerna3632
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:123522..127002 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507624.1
Product5-demethoxyubiquinone hydroxylase, mitochondrial, transcript variant X3
Model evidenceSupporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161278
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507624.1
GeneID107161278
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161278gene2457Diuraphis noxiageneJOTR01000065 122983..127002 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507624.1rna3632Diuraphis noxiapolypeptideJOTR01000065 126193..126909 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31727id31727Diuraphis noxiaexonJOTR01000065 123522..123606 +
id31728id31728Diuraphis noxiaexonJOTR01000065 126175..126346 +
id31729id31729Diuraphis noxiaexonJOTR01000065 126414..126563 +
id31730id31730Diuraphis noxiaexonJOTR01000065 126632..127002 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363110.1cds3536Diuraphis noxiaCDSJOTR01000065 126632..126909 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3632 ID=rna3632|Name=XM_015507624.1|organism=Diuraphis noxia|type=mRNA|length=778bp|location=Sequence derived from alignment at JOTR01000065:123522..127002+ (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
GCGTGAACGGATAACCACTTCGCCCGGTACGTAACGCGAACAGAGGGAAA
ACTGATGTAACGGCGATGGGAAAAAAACTCACCGCgctaacaataacaac
aaaatgaAAATGGTTCTGCAAAAAATGACATTTTCCAGAATAATTTTCCA
ACGAGGATTGCATGGTGCTAACAAAAAATTAGATAGTCTCATAAGAGTTA
ATCATGCTGGAGAACTTGGAGCTGATCGTATATATGCAGGACAGATGGCa
gtattagGAAACAGTAGTGTAGGTCCAAAGATTAAAGAGATGTGGGAACA
AGAAAAAGCGCACAGGTATAAATTTGAACAACTTATAAACCAAAATAGAG
TACGGCCATCACTGTTATTTCCTTTATGGTATTGTGCTGGCTATGTACTT
GGAgctggtacagCACTAATGGGTCCTAAAGCTGCTATGGCTTGCACTGT
TGCTGTAGAAACTGTTATCGTAGAACACTACAATGATCAATTACGACACC
TRATGGATGATCCCAAATCTGACAAAGAGCTTCTTGAAACCATCAAAAAG
TTTAGAGATGAAGAACAAGAACATCATGATTGTGGTATGGATCATGGGGC
TGAGCAAGCTCCATTTTATGATGCATTAACAAAAGTCATCAAAACTGGGT
GCAAAGTAGCTATTGAAGTAGCAAAAAGAGTGTGAATTTATCTCCTATAT
GATATCAgattataataactatgattaaatgtttaaattacctaaaatat
atttttaaagaataaatatttttattaa
back to top

protein sequence of XM_015507624.1

>rna3632 ID=rna3632|Name=XM_015507624.1|organism=Diuraphis noxia|type=polypeptide|length=194bp
MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAV
LGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLG
AGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKF
RDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV.
back to top

mRNA from alignment at JOTR01000065:123522..127002+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3632 ID=rna3632|Name=XM_015507624.1|organism=Diuraphis noxia|type=mRNA|length=3481bp|location=Sequence derived from alignment at JOTR01000065:123522..127002+ (Diuraphis noxia)
GCGTGAACGGATAACCACTTCGCCCGGTACGTAACGCGAACAGAGGGAAA ACTGATGTAACGGCGATGGGAAAAAAACTCACCGCGTATGCCTATATATG ATATCACGTTATATGTGTAGATTTATTTGACGTGTATTACATggtttgta ttgtataatagtcTACGTGTGTATTATACCGTAGAACACACGCACGTCAC GGGGACGCGGGCGGCGCGTTGTTATCGATCGGCCCCGTCCGTCCGGCCGA TCGATGTCGTCGCCATTTTGGTTGTACAGCCGTCGTCGTCTACCGTCGTA ACTCGTAGCAGCAGCAGTCGTGGCCGCCGCCGCGTGTCGTGTCGTGCAAT CCGACTACTCACAACGCGGCCGATTGTATTCTGTCGTACACGCTCCTACA CGGGCACCCCCCCGAGACGTTATTAATATACCATAAGATGCCctcgtatt attatgtaatattacaataatattgatgtttWTWCCGCgcttaatgatat aatattattaaatggtaataataataataatattattgtgcttgTTGCGA TAACAGTTTATAGTAGTAGTCGTCGGCGTTGTCGTCGTCTTTGTCGTTGT CGCAATTAAATACGCGTCTGCGCACCGACCCGTTCACGTCACTTTCGGAT ACTTCGCCGCCCCGGCGACACGTCGCGCCACTCGAGAGTCGAGACGGTTC TCGCACCAGTACGGCCGTATCTACCGCGAAAAACCGTTCGCCGAAAACCG CGGGCGTCAGAACGTTTTCCCGTTCAATCGTCGTTTCGACACCCAAACAG CGGTGTGTGTGCAAGGCGTAGGCACGCGCGAGCGTCGTAGTTATTAGGCC GTGCGGACCCGTACGTGTCGGTGGTTACTAGTTTTGCGCGCGTCAAGTGC TGAGCCGCGGTAGCCAGGAGACATTTTGWCACTCGACATACGCCATTGGT GCGCGCGCCCCGCCATCTRCTGGTAAATTAGCTCAGTCTCGGTTTTGCTT TACCCACCAAATTTCGAAATCGTGTGCAGAGTACCGTTTTCTTCGGTCTT AGCACCGTTTGTSACGACCTTCCAACTTACCTTCTCCGAATTAATGATCT ATTATTTATTCGCTGTACTGTAGTAGTCTTATCTACAAATTACTAGGCAT TCATATttcgaaatataattataaagtgcTGTCTGGTtgacatcatatta ataattagcttTGACTGCTTTGAGGTCACATCAAATCAGAAgtattaaga tattaattaatgtgGATGGtcgttattataacattatacaatcaACTGAT TTGATgctaattagaaattattatttacactttgggagatacattttaaa tgttttcaatttgatagataaataatttattattgtacatttaaaacttG TAAAGTGTAaccaattattttgttaaattaattcttTCCATTTTCTAAAG ATAAGTGAAgtgcttattttaattttaaatatttgtgtaaagCTAGGTAG TTGAACATTTTTAGTAACTTTTTTATTGGTTAGTTGTTGATAACTTGCAC ATAAGTCccaatagatacatattttaagtatactttaCAAATCACagatc atttatttatacatttattaacacTTAAATTGCATACTAATTGTACAGTC AATGCCATCTATGATGACTTTTAGGCACTTCATCATAATCATccatatca tcatcatcgtcttCACAAGAATGTGGATATTCTGACCTATGATTATCGTG TTTTGGCTTgagtatttctaaataaaaaataaaaccaattaataatttta caacgtaaacaaacagtttttaaatttacttcttTGGCAAAATTTCCCAA ACCATCCTTGTTGACAACGACATATTCTATTTGCTGTACAATATCCATGA TGGCAGGGCCTCttgcaattataatattgttttattggttGACCAATTTC ACAATGGTCTCCTTGAAAACCAAATATACATCTACATTTGTTCACTCCTT TACATTTTCCACCATTTAAACATGGTATAATACATTTAGCTGAAATTGTT AACTTTCTATTAGaactaatcattttttaaagtagATAAACTTACAGTAT TCACATCGTAAACCATAGAACCCCTTAGGACATTGGCATGTGtctttttg tatacattttccYCCATTTAAACACTTTTCTGCACAAATAcctgaaatgt ataaaaaaaaaaaatgatttttttRttttaaacaaaattctatattacac tatatgttacaattacaacaataaacataaaaggacgtcacacccgcatg tgttgtcttcgtYttacacacgtacgacataTYAGATTTCTGATCACTAC TATCAATAGGATGCTATCGGTATAGACATTAGAATGAATTagcctattat aaaacttaggtaagaacattatcgtGTTCGCTCGATctgttttcacaata ttttaatttttaagtgagtaatgagtattttaaaatattaatattttaca tacggAGACAGGGACAATATATGCAGGTGCGACATCCTCATAAGTGATAA GAGTTAGAAAATAAAGATTAGACAGGAGGAAAAGACCTCCCATCGGAAGT ACTWCAagcaaaaaatatgattaattttttttaaatgttatttttgatta taggctaacaataacaacaaaatgaAAATGGTTCTGCAAAAAATGACATT TTCCAGAATAATTTTCCAACGAGGATTGCATGGTGCTAACAAAAAATTAG ATAGTCTCATAAGAGTTAATCATGCTGGAGAACTTGGAGCTGATCGTATA TATGCAGGACAGATGGCagtattaggtatgtaaaaaatatgtattattca cATTTTATCAGTTGTTGATCTTAattatttgatcatttttaGGAAACAGT AGTGTAGGTCCAAAGATTAAAGAGATGTGGGAACAAGAAAAAGCGCACAG GTATAAATTTGAACAACTTATAAACCAAAATAGAGTACGGCCATCACTGT TATTTCCTTTATGGTATTGTGCTGGCTATGTACTTGGAgctggtaaatat tttaatacaaagataattgaatctaaaaatgtttaattaatataaaaatc atatttataggtacagCACTAATGGGTCCTAAAGCTGCTATGGCTTGCAC TGTTGCTGTAGAAACTGTTATCGTAGAACACTACAATGATCAATTACGAC ACCTRATGGATGATCCCAAATCTGACAAAGAGCTTCTTGAAACCATCAAA AAGTTTAGAGATGAAGAACAAGAACATCATGATTGTGGTATGGATCATGG GGCTGAGCAAGCTCCATTTTATGATGCATTAACAAAAGTCATCAAAACTG GGTGCAAAGTAGCTATTGAAGTAGCAAAAAGAGTGTGAATTTATCTCCTA TATGATATCAgattataataactatgattaaatgtttaaattacctaaaa tatatttttaaagaataaatatttttattaa
back to top

Coding sequence (CDS) from alignment at JOTR01000065:123522..127002+

>rna3632 ID=rna3632|Name=XM_015507624.1|organism=Diuraphis noxia|type=CDS|length=582bp|location=Sequence derived from alignment at JOTR01000065:123522..127002+ (Diuraphis noxia)
atgaAAATGGTTCTGCAAAAAATGACATTTTCCAGAATAATTTTCCAACG
AGGATTGCATGGTGCTAACAAAAAATTAGATAGTCTCATAAGAGTTAATC
ATGCTGGAGAACTTGGAGCTGATCGTATATATGCAGGACAGATGGCagta
ttagGAAACAGTAGTGTAGGTCCAAAGATTAAAGAGATGTGGGAACAAGA
AAAAGCGCACAGGTATAAATTTGAACAACTTATAAACCAAAATAGAGTAC
GGCCATCACTGTTATTTCCTTTATGGTATTGTGCTGGCTATGTACTTGGA
gctggtacagCACTAATGGGTCCTAAAGCTGCTATGGCTTGCACTGTTGC
TGTAGAAACTGTTATCGTAGAACACTACAATGATCAATTACGACACCTRA
TGGATGATCCCAAATCTGACAAAGAGCTTCTTGAAACCATCAAAAAGTTT
AGAGATGAAGAACAAGAACATCATGATTGTGGTATGGATCATGGGGCTGA
GCAAGCTCCATTTTATGATGCATTAACAAAAGTCATCAAAACTGGGTGCA
AAGTAGCTATTGAAGTAGCAAAAAGAGTGTGA
back to top