rna3634 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507626.1
Unique Namerna3634
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:125021..127295 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507626.1
Productprotein shifted
Model evidenceSupporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161279
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507626.1
GeneID107161279
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161279gene2458Diuraphis noxiageneJOTR01000065 125021..127295 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507626.1rna3634Diuraphis noxiapolypeptideJOTR01000065 125170..127146 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363112.1cds3534Diuraphis noxiaCDSJOTR01000065 125170..125288 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31738id31738Diuraphis noxiaexonJOTR01000065 125021..125288 -
id31737id31737Diuraphis noxiaexonJOTR01000065 125351..125560 -
id31736id31736Diuraphis noxiaexonJOTR01000065 125617..125712 -
id31735id31735Diuraphis noxiaexonJOTR01000065 127029..127295 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3634 ID=rna3634|Name=XM_015507626.1|organism=Diuraphis noxia|type=mRNA|length=841bp|location=Sequence derived from alignment at JOTR01000065:125021..127295- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
AATATAATCACTGATACCTAAACTATTAACTGTGAAATAATATTTATAAT
TGTATTATTTTCAAAGGTCTCGACTTAGTATGTGATAAAAAATGTGAGAA
CAATGGTTGGTGTAATGCGGATAAAGTTTGTCAGTGTCCTGAAGGTTACA
TGGGACAGTACTGCAAAACAGCATTGTGTTATCCACAGTGTATGAATAAT
GGGACATGTGTTGCCCCAGGTGTCTGTCGATGTCCACCAGGTTTTCAAGG
ACCACATTGTGAAGGAGGTATTTGTGCAGAAAAGTGTTTAAATGGRGGAA
AATGTATACAAAAAGACACATGCCAATGTCCTAAGGGGTTCTATGGTTTA
CGATGTGAATACTCTAAATGTATTATACCATGTTTAAATGGTGGAAAATG
TAAAGGAGTGAACAAATGTAGATGTATATTTGGTTTTCAAGGAGACCATT
GTGAAATTGGTCAACCAATAAAACAATATTATAATTGCAAGAGGCCCTGC
CATCATGGATATTGTACAGCAAATAGAATATGTCGTTGTCAACAAGGATG
GTTTGGGAAATTTTGCCAAAGAAAAATACTCAAGCCAAAACACGATAATC
ATAGGTCAGAATATCCACATTCTTGTGAAGACGATGATGATGATATGGAT
GATTATGATGAAGTGCCTAAAAGTCATCATAGATGGCATTGACTGTACAA
TTAGTATGCAATTTAAGTGTTAATAAATGTATAAATAAATGATCTGTGAT
TTGTAAAGTATACTTAAAATATGTATCTATTGGGACTTATGTGCAAGTTA
TCAACAACTAACCAATAAAAAAGTTACTAAAAATGTTCAAC
back to top

protein sequence of XM_015507626.1

>rna3634 ID=rna3634|Name=XM_015507626.1|organism=Diuraphis noxia|type=polypeptide|length=181bp
MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGG
KCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDH
CEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDN
HRSEYPHSCEDDDDDMDDYDEVPKSHHRWH.
back to top

mRNA from alignment at JOTR01000065:125021..127295-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3634 ID=rna3634|Name=XM_015507626.1|organism=Diuraphis noxia|type=mRNA|length=2275bp|location=Sequence derived from alignment at JOTR01000065:125021..127295- (Diuraphis noxia)
AATATAATCACTGATACCTAAACTATTAACTGTGAAATAATATTTATAAT TGTATTATTTTCAAAGGTCTCGACTTAGTATGTGATAAAAAATGTGAGAA CAATGGTTGGTGTAATGCGGATAAAGTTTGTCAGTGTCCTGAAGGTTACA TGGGACAGTACTGCAAAACAGCATTGTGTTATCCACAGTGTATGAATAAT GGGACATGTGTTGCCCCAGGTGTCTGTCGATGTCCACCAGGTTTTCAAGG ACCACATTGTGAAGGAGGTAGTAGTTTTAAGTGTTTTAACCAATTAATAA AAATATTTATTCTTTAAAAATATATTTTAGGTAATTTAAACATTTAATCA TAGTTATTATAATCTGATATCATATAGGAGATAAATTCACACTCTTTTTG CTACTTCAATAGCTACTTTGCACCCAGTTTTGATGACTTTTGTTAATGCA TCATAAAATGGAGCTTGCTCAGCCCCATGATCCATACCACAATCATGATG TTCTTGTTCTTCATCTCTAAACTTTTTGATGGTTTCAAGAAGCTCTTTGT CAGATTTGGGATCATCCATYAGGTGTCGTAATTGATCATTGTAGTGTTCT ACGATAACAGTTTCTACAGCAACAGTGCAAGCCATAGCAGCTTTAGGACC CATTAGTGCTGTACCTATAAATATGATTTTTATATTAATTAAACATTTTT AGATTCAATTATCTTTGTATTAAAATATTTACCAGCTCCAAGTACATAGC CAGCACAATACCATAAAGGAAATAACAGTGATGGCCGTACTCTATTTTGG TTTATAAGTTGTTCAAATTTATACCTGTGCGCTTTTTCTTGTTCCCACAT CTCTTTAATCTTTGGACCTACACTACTGTTTCCTAAAAATGATCAAATAA TTAAGATCAACAACTGATAAAATGTGAATAATACATATTTTTTACATACC TAATACTGCCATCTGTCCTGCATATATACGATCAGCTCCAAGTTCTCCAG CATGATTAACTCTTATGAGACTATCTAATTTTTTGTTAGCACCATGCAAT CCTCGTTGGAAAATTATTCTGGAAAATGTCATTTTTTGCAGAACCATTTT CATTTTGTTGTTATTGTTAGCCTATAATCAAAAATAACATTTAAAAAAAA TTAATCATATTTTTTGCTTGWAGTACTTCCGATGGGAGGTCTTTTCCTCC TGTCTAATCTTTATTTTCTAACTCTTATCACTTATGAGGATGTCGCACCT GCATATATTGTCCCTGTCTCCGTATGTAAAATATTAATATTTTAAAATAC TCATTACTCACTTAAAAATTAAAATATTGTGAAAACAGATCGAGCGAACA CGATAATGTTCTTACCTAAGTTTTATAATAGGCTAATTCATTCTAATGTC TATACCGATAGCATCCTATTGATAGTAGTGATCAGAAATCTRATATGTCG TACGTGTGTAARACGAAGACAACACATGCGGGTGTGACGTCCTTTTATGT TTATTGTTGTAATTGTAACATATAGTGTAATATAGAATTTTGTTTAAAAY AAAAAAATCATTTTTTTTTTTTATACATTTCAGGTATTTGTGCAGAAAAG TGTTTAAATGGRGGAAAATGTATACAAAAAGACACATGCCAATGTCCTAA GGGGTTCTATGGTTTACGATGTGAATACTGTAAGTTTATCTACTTTAAAA AATGATTAGTTCTAATAGAAAGTTAACAATTTCAGCTAAATGTATTATAC CATGTTTAAATGGTGGAAAATGTAAAGGAGTGAACAAATGTAGATGTATA TTTGGTTTTCAAGGAGACCATTGTGAAATTGGTCAACCAATAAAACAATA TTATAATTGCAAGAGGCCCTGCCATCATGGATATTGTACAGCAAATAGAA TATGTCGTTGTCAACAAGGATGGTTTGGGAAATTTTGCCAAAGAAGTAAA TTTAAAAACTGTTTGTTTACGTTGTAAAATTATTAATTGGTTTTATTTTT TATTTAGAAATACTCAAGCCAAAACACGATAATCATAGGTCAGAATATCC ACATTCTTGTGAAGACGATGATGATGATATGGATGATTATGATGAAGTGC CTAAAAGTCATCATAGATGGCATTGACTGTACAATTAGTATGCAATTTAA GTGTTAATAAATGTATAAATAAATGATCTGTGATTTGTAAAGTATACTTA AAATATGTATCTATTGGGACTTATGTGCAAGTTATCAACAACTAACCAAT AAAAAAGTTACTAAAAATGTTCAAC
back to top

Coding sequence (CDS) from alignment at JOTR01000065:125021..127295-

>rna3634 ID=rna3634|Name=XM_015507626.1|organism=Diuraphis noxia|type=CDS|length=543bp|location=Sequence derived from alignment at JOTR01000065:125021..127295- (Diuraphis noxia)
ATGGGACAGTACTGCAAAACAGCATTGTGTTATCCACAGTGTATGAATAA
TGGGACATGTGTTGCCCCAGGTGTCTGTCGATGTCCACCAGGTTTTCAAG
GACCACATTGTGAAGGAGGTATTTGTGCAGAAAAGTGTTTAAATGGRGGA
AAATGTATACAAAAAGACACATGCCAATGTCCTAAGGGGTTCTATGGTTT
ACGATGTGAATACTCTAAATGTATTATACCATGTTTAAATGGTGGAAAAT
GTAAAGGAGTGAACAAATGTAGATGTATATTTGGTTTTCAAGGAGACCAT
TGTGAAATTGGTCAACCAATAAAACAATATTATAATTGCAAGAGGCCCTG
CCATCATGGATATTGTACAGCAAATAGAATATGTCGTTGTCAACAAGGAT
GGTTTGGGAAATTTTGCCAAAGAAAAATACTCAAGCCAAAACACGATAAT
CATAGGTCAGAATATCCACATTCTTGTGAAGACGATGATGATGATATGGA
TGATTATGATGAAGTGCCTAAAAGTCATCATAGATGGCATTGA
back to top