rna3644 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507615.1
Unique Namerna3644
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:480476..481562 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507615.1
ProductCOP9 signalosome complex subunit 8
Model evidenceSupporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161273
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507615.1
GeneID107161273
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161273gene2466Diuraphis noxiageneJOTR01000065 480476..481562 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507615.1rna3644Diuraphis noxiapolypeptideJOTR01000065 480538..481181 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363101.1cds3547Diuraphis noxiaCDSJOTR01000065 480538..481069 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31820id31820Diuraphis noxiaexonJOTR01000065 480476..481069 -
id31819id31819Diuraphis noxiaexonJOTR01000065 481156..481562 -


Sequences
The following sequences are available for this feature:

protein sequence of XM_015507615.1

>rna3644 ID=rna3644|Name=XM_015507615.1|organism=Diuraphis noxia|type=polypeptide|length=186bp
MIPEPLDVSFVIEELENDEIQEGSLTTEQYTKLFSAYLYTNELCAAKFLW
RRVPESIKSDPELHKVWSIGKALWTKHYTQAYELIDCKWSNVLEPIMIAI
KRRIQQDTLKFISMHYENIQLDKFQTFMGVDKEQAERIVESEGWTCKNGY
VMPIAINESDLGLGGSQDILDRLVTLSSFTSYIEN.
back to top

mRNA from alignment at JOTR01000065:480476..481562-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3644 ID=rna3644|Name=XM_015507615.1|organism=Diuraphis noxia|type=mRNA|length=1087bp|location=Sequence derived from alignment at JOTR01000065:480476..481562- (Diuraphis noxia)
TTCCAGTCATGTTTATCTTGGTCCGTGAGTCGTGACTCGTGACCCGTGTC ATTTAAACTTGAGTAGTCGAGTCTGTTTTCGGGCGGCAAGACGAGCAATA ATTGGTGTCCATTCCAATATTTCGAATACTATCGAATAAATCAAAACCAT TGAATAGTTCAAATGATCCGGACTATCGAATAATTCGATACTACCCATCA ATAGTCGTATTAGGACCAAAAGAAAAGTCATTAAAAACCGTCAAAAGACT GAAGATCGATATTTGATTTGACCGAATAATTTTAGTATATCACTAAATCA TTCGGTCGCGATCCGGTTACTCGACAGATTCGTTAATTTTGATTCATTTA GTCGCGAGTCGCGACCATCGAAACTCTAAGTATGATCCCCGAACCACTCG ACGTCAGGTAGGCATAGTTTATGGTCGTCCAAGGACAATTTATGATTTGC GGTTTCAGTATGGTAATATAGTCGATTATTGTCCGTGTTTCAGTTTTGTC ATCGAAGAGCTTGAAAACGACGAGATCCAAGAAGGCAGTCTGACAACCGA ACAGTACACCAAATTGTTTTCCGCCTACTTGTACACCAATGAACTGTGTG CCGCCAAATTCTTGTGGCGCCGTGTGCCCGAGTCAATCAAGTCCGATCCT GAATTGCATAAAGTCTGGTCGATTGGCAAAGCCCTCTGGACGAAACATTA CACACAAGCATATGAACTGATTGACTGCAAGTGGTCCAATGTACTAGAGC CCATCATGATTGCAATCAAACGTCGCATCCAACAGGACACATTGAAGTTC ATTAGTATGCACTATGAAAACATACAACTTGACAAATTTCAAACATTCAT GGGTGTAGACAAAGAACAAGCTGAGAGAATAGTGGAAAGTGAAGGTTGGA CATGCAAAAATGGTTATGTAATGCCAATAGCAATCAATGAATCCGATTTG GGATTAGGTGGTAGTCAAGATATTCTGGATAGATTAGTGACTCTATCATC ATTTACGTCTTATATTGAAAATTGAATCAATTTACTGTTTGTGTATTTAA TTAATTTAAGTCTGATCCTAACCTATTAAAATAAGAT
back to top

Coding sequence (CDS) from alignment at JOTR01000065:480476..481562-

>rna3644 ID=rna3644|Name=XM_015507615.1|organism=Diuraphis noxia|type=CDS|length=558bp|location=Sequence derived from alignment at JOTR01000065:480476..481562- (Diuraphis noxia)
ATGATCCCCGAACCACTCGACGTCAGTTTTGTCATCGAAGAGCTTGAAAA
CGACGAGATCCAAGAAGGCAGTCTGACAACCGAACAGTACACCAAATTGT
TTTCCGCCTACTTGTACACCAATGAACTGTGTGCCGCCAAATTCTTGTGG
CGCCGTGTGCCCGAGTCAATCAAGTCCGATCCTGAATTGCATAAAGTCTG
GTCGATTGGCAAAGCCCTCTGGACGAAACATTACACACAAGCATATGAAC
TGATTGACTGCAAGTGGTCCAATGTACTAGAGCCCATCATGATTGCAATC
AAACGTCGCATCCAACAGGACACATTGAAGTTCATTAGTATGCACTATGA
AAACATACAACTTGACAAATTTCAAACATTCATGGGTGTAGACAAAGAAC
AAGCTGAGAGAATAGTGGAAAGTGAAGGTTGGACATGCAAAAATGGTTAT
GTAATGCCAATAGCAATCAATGAATCCGATTTGGGATTAGGTGGTAGTCA
AGATATTCTGGATAGATTAGTGACTCTATCATCATTTACGTCTTATATTG
AAAATTGA
back to top