rna3656 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507636.1
Unique Namerna3656
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:621137..627364 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507636.1
ProductDENN domain-containing protein 1B-like, transcript variant X1
Model evidenceSupporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161284
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507636.1
GeneID107161284
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161284gene2472Diuraphis noxiageneJOTR01000065 621137..627364 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507636.1rna3656Diuraphis noxiapolypeptideJOTR01000065 621415..626958 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363122.1cds3560Diuraphis noxiaCDSJOTR01000065 621415..621822 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31950id31950Diuraphis noxiaexonJOTR01000065 621137..621822 -
id31949id31949Diuraphis noxiaexonJOTR01000065 621885..621999 -
id31948id31948Diuraphis noxiaexonJOTR01000065 622057..622277 -
id31947id31947Diuraphis noxiaexonJOTR01000065 622332..622364 -
id31946id31946Diuraphis noxiaexonJOTR01000065 623107..623283 -
id31945id31945Diuraphis noxiaexonJOTR01000065 623403..623630 -
id31944id31944Diuraphis noxiaexonJOTR01000065 624974..625075 -
id31943id31943Diuraphis noxiaexonJOTR01000065 625140..625397 -
id31942id31942Diuraphis noxiaexonJOTR01000065 625981..626034 -
id31941id31941Diuraphis noxiaexonJOTR01000065 626100..626235 -
id31940id31940Diuraphis noxiaexonJOTR01000065 626311..626448 -
id31939id31939Diuraphis noxiaexonJOTR01000065 626507..626665 -
id31938id31938Diuraphis noxiaexonJOTR01000065 626942..626968 -
id31937id31937Diuraphis noxiaexonJOTR01000065 627280..627364 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3656 ID=rna3656|Name=XM_015507636.1|organism=Diuraphis noxia|type=mRNA|length=2419bp|location=Sequence derived from alignment at JOTR01000065:621137..627364- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
ACTAGTAATTAGTATGTTCCCAATCAGCATTGAACATCTTAAATCACAGA
ACATTACTTAAATCGAATATTATATTATTATCTAACTTTGATGGAATGGG
GTCACGGATAAGGAATGATGTTGTTCGTTTATTTGAGTGTTTCTGTGAAG
TAGCTGGCCCTAGTAAAGAAAACACAGTCCCGTGGATTCTCCAAAAGTTT
CCAGAGCACTATAGAAAAGATGAACTGCTCGGCACTGTCCCTAATTTTGC
ATATCCTTGTGATTTTGACAGAACCACGATTCAACACTACTCATTTGTAC
TGACTAATGCGGAATCGAAGTGGATTTTTGGATTTTGTAGACATGACCCT
AAATCTGAGACTGCTTTAGTTGTTCTCAGTTATCTTCCTTGGCATGAATC
ATTTTATAAATTATTAAATTGTATATCTAATCTAACAAACAATAACAATT
CTAAAGATCTATGGTCATTTTTGGAATCTGTRTATAATAGTAAGCTACCA
ATCAAAGGACTTGACTTAAAAATTAATAGTGATAGCGGCGAAGAGTTATT
TGTGTGTCAGTCGCCAATTCAATTCCAGTTACCAAGCATTCCAGAAAATA
GAAATTTGACAGAATATTACAGTGCAGTTGATTGTCAAAATATGATTATT
ATATTTGCATCAATGTTATTTGAACGTCGTATTATTTTTACTTCCAAAAA
ACTATACAGATTGAGTGCCTGTGTTCAATCTGCTAATGCAGTTCTATATC
CAATGAATTGGCAACACATATTTATACCAGTATTACCTCAATCACTTATT
GATTACTTATTAGCACCAATGCCATACTTAATCGGCTTACCTCACTCATT
ATTCCAAAGTTTGCAACGTAATGACTTAGGAGATGTCGTTATTCTAGATG
CAGATAATAATACTATAGAAACTCCATTTGATGATATGGAAAATCTTCCT
GCAGATGTTGTATCAACTTTAAGACGACAGTTACGAAATAAAGGTACACT
CTTAGGTGATGGTGTATCTAGAGCATTTTTACGTGCTTTAGTTAAGTTAA
TTGGCGGGTATAGGGATGCATTAAAATTTCATCAAGGAGAACGTATCACA
TTTAATAAAGAAGCATTTATCGAATCTAGATCAGCAAATATGCAACCATT
TTTAAAAAAAATGTTGGAATTGCAGATTTTTCAACAGTTTATAGAAGAAA
GATTAGAAATGTTAAATGCAGGACTTGGATTTTCTGATGAATTTGAAATG
GAAGTTTGTAACTACCATGATAAATCTAGTAATAGATTAAAGCATCAGTA
TAAAGATTGGACATTCACTATGAAACGTGAAGGAACTGCATTATTTAAAA
GTGTGAAGAATGCAGCTAATCCTACAGTAAGAAATGCTGTAAAAACGGTT
AAAGAACGAGGAAAAGATTTTCGGTTGGTTTACAAAGACATTAGATCAAA
ATTCAATGTTCCAAATAAAAATCCTCGAACCAAAATCAGTACCCATCCAA
ATTCTGCTCCAAACTCTCCTTCAATGCCGAAGAGACAATCTTGGTCACAT
ACAACAGCATCTGCTAGCTATCGTAAAGAAACTGCCAACGGATTACAAAA
ATTAACTACATCTCAAAATTTTAAAGATGCCTCGATTTCACCGCTACCAC
AAATTAATTTGAACTTAATGGAAGATCTACAAGATGTTATATTCAGAACT
TGTGATAATGATGATCCACAAAATTATACATCATCCTGGGATGATTCAGT
CAAATCAAATTTTATCATAAATGATGATTTAATAAACTCGTCATTTGGAT
CTGTGCCAAGTGAGTGTCCTATGGAAACTAAAGATCTGATTCGGTTGGAT
TCAACATCTAGTATAGAAGATTTTGATCCTTTAAATAGTCCAACTAATAG
TAATGGTTTGATTCCAGGAGTAGGTCTTAGTAATCCACTGTATCAGTATT
TTGTTCCATTAAATAAAACTCAATTAGAAACCAAAAACAATAATGACCTC
CTTAATGAGTATGGATTAAACTTTGATTTGTTAAGTTGTACTGATCAACC
CGGTCCATCCATGTCACCGAGTCAACCCACTGTACCTCCATTACCACCAA
AACCACCCAATTTTAAATCAAATTGGACCAAATTTGAATAAAATTACAAA
TCTAGAATTTATAATTTTAAAATACTTGTGATAAAAAYATTTTATTTTGC
AATCACACTACTTTTAAGCTAGTGGTTACCACTTATATTAAATATTTTAC
AACATTGTCCATGTTTACATTTTATCAACATTTTTTTATATACTCATATA
TTATTGTTACACCAAATATTAACAAATGGACCAGAATGTTGTGTCTGATT
TAGATTGTTTAACGCTCATAAATGTAGTTGTATATTACATGTTATACATG
GTAAAAATTGTATGTTTAT
back to top

protein sequence of XM_015507636.1

>rna3656 ID=rna3656|Name=XM_015507636.1|organism=Diuraphis noxia|type=polypeptide|length=682bp
MGSRIRNDVVRLFECFCEVAGPSKENTVPWILQKFPEHYRKDELLGTVPN
FAYPCDFDRTTIQHYSFVLTNAESKWIFGFCRHDPKSETALVVLSYLPWH
ESFYKLLNCISNLTNNNNSKDLWSFLESVYNSKLPIKGLDLKINSDSGEE
LFVCQSPIQFQLPSIPENRNLTEYYSAVDCQNMIIIFASMLFERRIIFTS
KKLYRLSACVQSANAVLYPMNWQHIFIPVLPQSLIDYLLAPMPYLIGLPH
SLFQSLQRNDLGDVVILDADNNTIETPFDDMENLPADVVSTLRRQLRNKG
TLLGDGVSRAFLRALVKLIGGYRDALKFHQGERITFNKEAFIESRSANMQ
PFLKKMLELQIFQQFIEERLEMLNAGLGFSDEFEMEVCNYHDKSSNRLKH
QYKDWTFTMKREGTALFKSVKNAANPTVRNAVKTVKERGKDFRLVYKDIR
SKFNVPNKNPRTKISTHPNSAPNSPSMPKRQSWSHTTASASYRKETANGL
QKLTTSQNFKDASISPLPQINLNLMEDLQDVIFRTCDNDDPQNYTSSWDD
SVKSNFIINDDLINSSFGSVPSECPMETKDLIRLDSTSSIEDFDPLNSPT
NSNGLIPGVGLSNPLYQYFVPLNKTQLETKNNNDLLNEYGLNFDLLSCTD
QPGPSMSPSQPTVPPLPPKPPNFKSNWTKFE.
back to top

mRNA from alignment at JOTR01000065:621137..627364-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3656 ID=rna3656|Name=XM_015507636.1|organism=Diuraphis noxia|type=mRNA|length=6228bp|location=Sequence derived from alignment at JOTR01000065:621137..627364- (Diuraphis noxia)
ACTAGTAATTAGTATGTTCCCAATCAGCATTGAACATCTTAAATCACAGA ACATTACTTAAATCGAATATTATATTATTATCTAAGTAAGTGACGCGGTG GGGGATGGATTAGATTAGAAAATGTGTAGTAGGAGATGTGTTATCTCTGG TTTAAATTAAAATGAAACTTTTGAGATTTTGAGTTCCTTAACTCAATATT AAATACTYATTATTCATCTGCTAACTGCTTATCTAATATTAAAAAAGTTG GACTATTTTGAAACCTATGTAGTTATAAATTCGTTGGACGTTGGAGACGT GTATCTAATGTTCTGATGTCTTGCTAAACGTTCATATTTTATAATTTATT TACCTATACAGGAATATTTATATGTTTATTTGTCAATTCATAACAGCTTT GATGGAATGGGGTCACGGATAAGGTGAGCAGTTACAATTTCATTCAATTA ATTGTTATATCATTGATTTAATAAATTTATTTGTCTCCTCTCTCTCTCTC TCTAGTAGTTTAATATTTTAAGACAATTGTTTTATTGTTAAGTGTGCATT AATTATTGTAGTGTAATATAGYAAATATTTGATATTTCTTTGCCCAAACA GCATTAGATTTTTATTGAATTACGTTTGTTATAAGTGGTCAGTGCTTATA ATTTATGAATTATATAGCATGTATATTAATCTTCATTGTATTATACCAGG AATGATGTTGTTCGTTTATTTGAGTGTTTCTGTGAAGTAGCTGGCCCTAG TAAAGAAAACACAGTCCCGTGGATTCTCCAAAAGTTTCCAGAGCACTATA GAAAAGATGAACTGCTCGGCACTGTCCCTAATTTTGCATATCCTTGTGAT TTTGACAGGTAGTATTAAATATTAACTAACAATATCAAACCTTATTCTAA TAATTTGAATGTTTAGAACCACGATTCAACACTACTCATTTGTACTGACT AATGCGGAATCGAAGTGGATTTTTGGATTTTGTAGACATGACCCTAAATC TGAGACTGCTTTAGTTGTTCTCAGTTATCTTCCTTGGCATGAATCATTTT ATAAGTAAAAACTATTTAAAATTTACAGAATTTTTTTTTTTCGGGTAATG GAAATGTATCATACTTGTTTCTGTTTTAGATTATTAAATTGTATATCTAA TCTAACAAACAATAACAATTCTAAAGATCTATGGTCATTTTTGGAATCTG TRTATAATAGTAAGCTACCAATCAAAGGACTTGACTTAAAAATTAATAGT GATAGCGGCGAAGAGGTAATTAATTTACAATACATTTTTAGTAAAGTTTT AAAATATTTCCTTATTTTAATTTATTATAGTTATTTGTGTGTCAGTCGCC AATTCAATTCCAGTTACCAAGCATTCCAGAAAATGTAAGTAGCTTGCAGC TTAAATTGAACTATGGTATTCTAACCAATTCTAATGAAGCGTTCCCACGG TGCGTTAATCACGACAGTGAACCACGCTTTTGTGAAATACACTTCTGTGT GAACGCATAGTCATTAAACTTTCTTTTGTGAGGAACGGCGCACGACTCAA GCGTGGATAGATCAAACATGTTTGATTTTCAGTCGTGATATACTGTTTGT GAAGCAAAGATGTCGTCACAGCAACRTGGAATTATCGACGGCACGAACCC AACCATGTGAACATTTCATCAATTCACACTTTCGTGAGTGTCACAAACGA AAGTTGACTAGCGTGGTTGACTATCATGATTAACGCCTCGTGGGAACGCA GCATAATAATTTATGATTTTAATAATTCATTGAAATAAGCATTATTTATA AATGGTTTAAGTTACTATTTAGTGCATTATGTACTTATTTATGATAATGT GTAGATTCATATATCTTAATTTAGTTAAAAAATATAAAAATAAAATCAAT AAAACATAAATTATTTTTTACTGAACTATCAGATTTTCAACTGAAGATTG ATTTAAATTTTTTTTAGAGAAATTTGACAGAATATTACAGTGCAGTTGAT TGTCAAAATATGATTATTATATTTGCATCAATGTTATTTGAACGTCGTAT TATTTTTACTTCCAAAAAACTATACAGATTGAGTGCCTGTGTTCAATCTG CTAATGCAGTTCTATATCCAATGAATTGGCAACACATATTTATACCAGTA TTACCTCAATCACTTATTGATTACTTATTAGCACCAATGCCATACTTAAT CGGCTTACCTCACTCATTATTCCAAGTAACTATTTTCTATTATTTAAATT TTGTTTTTGTCATTTATTACAATTCTTGTTATTTTTTAGAGTTTGCAACG TAATGACTTAGGAGATGTCGTTATTCTAGATGCAGATAATAATACTATAG AAACTCCATTTGATGATATGGAAAATCTTCCTGCAGATGTTGTCAGTAAA TATTTAATAGTACAACTACCAAACTTATTACTCTATCGAATGTGATATAT ATGAGTAATCTTAGGCAGCGAAAATATGTATGCATGATAAGTACCGCATT TTCGAAAGCATCACTTAATTMTTTTAATAACCACCTTGCTTGCATTGCAG TAAGATTAATAAAACTATAAAAGCGATTTTCAGTTGCCGTTTGGTTTTTA GGAACAAAATTTGATGTAATCCAGTGGTTTTCAAATCATAATCCATGAGA GTAATCTAGGTGCTCTGTAGACATGTCTAAATTAAATTAAATTAAAATAA TATTTTGTTAATTTATCATTAATAAGTATTAACCCACATATTTTGTTTTG TTACTCATACAACCTCAAGTTATGGATGTCTATGTTTGAACATTTCTAAT TTTTAAGGCCTTGTCGAATTTTCTAAGTGCTCAACAAATAAAAAAGTTAA AAATCACTGACAAGCCATTTTTCAAGGGATGGGTATGGTGTGACTGGACT GTATAAAAATTGGTTGCTACTTGAGATTACTCTTATATGAGACAGAATTT AAATGTTTCTGTACCACTAAATATTTTATTTTTTACGTATTTAAGAGTTT CATTTCAAAGAATACAATTAGGATTAAAAACAATCTATTTAATTTTAAAC AGATAGTCTTAAATTATGGTTTTAGTTGTAAAAAAGCTTTAACGCTTAAG AGGACGTGATACCCTCATGTGTTGTCTCCGTGTTACAAGTGCGTAACATA CCAAAAACTGTTTCRCGCRGGTAAGAACTGAGAAATCTACAGTTATGAGT TATAACTAAGAAACCAAATTTTTGCCATGAAAAAAGAAGAATTATTACTT TGTCTCAGCATTTTAATTTTTTCAATAAGACCAATATATCAAAAGATTTT TTAGAGTATAAATTTTTTCTTATTAAAGATATCAAACAAATAAAAACGCT ACGACACAAAAAATATTATCTTCTATATTATTATTATGTTAACTTTTGTT ATTTCTACTAAAAGTACAGACTGAGTGGTTTTATCCTGCGCTAGTTTTTG CAATGTTACGCTGTAAGACGAAGAAAACACATGTGGGTATCACGTCCTCT TAAGTCACTTATTTATTGGTTTGAAAGCTAGTTGGTACTTTAATGACACA TTTTTTTCAGTAAATTCCTTTAGTGTAAATAATATTTATCAATCTGCACT TTATCCTGAGCTTTCAAAGTATTWTTTTAAATGTTATGGTTTATCACTGA TTTTGAATTCAATATTACAACAAATGTAATTTTCCATTACCTATTGTTAT GAGTCATTGGAGATCTTTTTAATTTTTATTTTAGGTATCAACTTTAAGAC GACAGTTACGAAATAAAGGTACACTCTTAGGTGATGGTGTATCTAGAGCA TTTTTACGTGCTTTAGTTAAGTTAATTGGCGGGTATAGGGATGCATTAAA ATTTCATCAAGGAGAACGTATCACATTTAATAAAGAAGCATTTATCGAAT CTAGATCAGCAAATATGCAACCATTTTTAAAAAAAATGTTGGAATTGCAG ATTTTTCAACAGGTATAGTCATTGTATATGTTCTAAGTAATGATAATTTT TTGTATAATGAATATTAGTATTTAGTAATATAATACTTAAAATATATCAA TATATCTCAAAATTAATTATTTTGTTCATAGTTTATAGAAGAAAGATTAG AAATGTTAAATGCAGGACTTGGATTTTCTGATGAATTTGAAATGGAAGTT TGTAACTACCATGATAAATCTAGTAATAGATTAAAGCATCAGTATAAAGA TTGGACATTCACTATGAAACGTGAAGGAACTGCATTATTTAAAAGTGTGA AGAATGCAGTAAGTTAATAATTTTAAGATTTGTTTTATTGGGGATGTTAG ATATTATAATTGCTATCATTTGCCATATTGTTATAACGTAGAGGACATTT TTGATTTACAAATTATACCGAGCGAACAATTAATATTAAAAATAAAAACC ATTTTACGCGTTTTAAAATATTATGCAAAAAAAAAAAAATCATTAAAATA GTTTTTTATATTAAGATACTAATGTAAATTTTAATGTTATATCAAATTCT TATTTATAATTTAATCAGTATAATATAAAATATTTTAGGTTTTATACCTT GTTTCAAAAGAGAATACACCAGGCTGCGACCAGTTTCCGCCGGTGGTGCG CACCATGGGTAATGACTGGTAGAAGAAGAAAACAGTTGGCTGAACTACTA TATTCTCTTTTGAAATAAAGTATAGTTGATAAAATGAAATAAAAAATAAA TAAATGAAATATTCCAAAAATATTATTTTGAGACTTATCATAAAATTTAT AAATTTACCAACTTTAAAATGTTTCCTGGATGTATCTAATTTTTTTTTAA ATCTTATTGGACTTACTTGATAACAGCATACAGTAGGTATTTTTATTTTG TATTTAATAGAATATGAATCTTAATAAACAAATTTTTGGACTTATAATTT TTGTGAGGTAATTTATGATTAGTTAAATTTTTAATTACAAATATTTTCTT AGAAATCATTAAACTAATCATATTATAACATTTTCATTGTTAATTTTCAG GCTAATCCTACAGTAAGAAATGCTGTAAAAACGGTAAATTAGTTTCATGT AAAAATAAAACTTTTATATCATATGATACGTTTTTAGGTTAAAGAACGAG GAAAAGATTTTCGGTTGGTTTACAAAGACATTAGATCAAAATTCAATGTT CCAAATAAAAATCCTCGAACCAAAATCAGTACCCATCCAAATTCTGCTCC AAACTCTCCTTCAATGCCGAAGAGACAATCTTGGTCACATACAACAGCAT CTGCTAGCTATCGTAAAGAAACTGCCAACGGATTACAAAAATTAACTACA TCTCAAAAGTAAACAAATATTTATTCGCTATTATTACAGTTTTACCAAAT ATCTATTTTTCATAGTTTTAAAGATGCCTCGATTTCACCGCTACCACAAA TTAATTTGAACTTAATGGAAGATCTACAAGATGTTATATTCAGAACTTGT GATAATGATGATCCACAAAATTATACATCAGTATGTTGAAAAAAATTAAC AATTTTTAATTCTTGAGAATTAATAAAATATTTTGTGTTTAGTCCTGGGA TGATTCAGTCAAATCAAATTTTATCATAAATGATGATTTAATAAACTCGT CATTTGGATCTGTGCCAAGTGAGTGTCCTATGGAAACTAAAGATCTGATT CGGTTGGATTCAACATCTAGTATAGAAGATTTTGATCCTTTAAATAGTCC AACTAATAGTAATGGTTTGATTCCAGGAGTAGGTCTTAGTAATCCACTGT ATCAGTATTTTGTTCCATTAAATAAAACTCAATTAGAAACCAAAAACAAT AATGACCTCCTTAATGAGTATGGATTAAACTTTGATTTGTTAAGTTGTAC TGATCAACCCGGTCCATCCATGTCACCGAGTCAACCCACTGTACCTCCAT TACCACCAAAACCACCCAATTTTAAATCAAATTGGACCAAATTTGAATAA AATTACAAATCTAGAATTTATAATTTTAAAATACTTGTGATAAAAAYATT TTATTTTGCAATCACACTACTTTTAAGCTAGTGGTTACCACTTATATTAA ATATTTTACAACATTGTCCATGTTTACATTTTATCAACATTTTTTTATAT ACTCATATATTATTGTTACACCAAATATTAACAAATGGACCAGAATGTTG TGTCTGATTTAGATTGTTTAACGCTCATAAATGTAGTTGTATATTACATG TTATACATGGTAAAAATTGTATGTTTAT
back to top

Coding sequence (CDS) from alignment at JOTR01000065:621137..627364-

>rna3656 ID=rna3656|Name=XM_015507636.1|organism=Diuraphis noxia|type=CDS|length=2046bp|location=Sequence derived from alignment at JOTR01000065:621137..627364- (Diuraphis noxia)
ATGGGGTCACGGATAAGGAATGATGTTGTTCGTTTATTTGAGTGTTTCTG
TGAAGTAGCTGGCCCTAGTAAAGAAAACACAGTCCCGTGGATTCTCCAAA
AGTTTCCAGAGCACTATAGAAAAGATGAACTGCTCGGCACTGTCCCTAAT
TTTGCATATCCTTGTGATTTTGACAGAACCACGATTCAACACTACTCATT
TGTACTGACTAATGCGGAATCGAAGTGGATTTTTGGATTTTGTAGACATG
ACCCTAAATCTGAGACTGCTTTAGTTGTTCTCAGTTATCTTCCTTGGCAT
GAATCATTTTATAAATTATTAAATTGTATATCTAATCTAACAAACAATAA
CAATTCTAAAGATCTATGGTCATTTTTGGAATCTGTRTATAATAGTAAGC
TACCAATCAAAGGACTTGACTTAAAAATTAATAGTGATAGCGGCGAAGAG
TTATTTGTGTGTCAGTCGCCAATTCAATTCCAGTTACCAAGCATTCCAGA
AAATAGAAATTTGACAGAATATTACAGTGCAGTTGATTGTCAAAATATGA
TTATTATATTTGCATCAATGTTATTTGAACGTCGTATTATTTTTACTTCC
AAAAAACTATACAGATTGAGTGCCTGTGTTCAATCTGCTAATGCAGTTCT
ATATCCAATGAATTGGCAACACATATTTATACCAGTATTACCTCAATCAC
TTATTGATTACTTATTAGCACCAATGCCATACTTAATCGGCTTACCTCAC
TCATTATTCCAAAGTTTGCAACGTAATGACTTAGGAGATGTCGTTATTCT
AGATGCAGATAATAATACTATAGAAACTCCATTTGATGATATGGAAAATC
TTCCTGCAGATGTTGTATCAACTTTAAGACGACAGTTACGAAATAAAGGT
ACACTCTTAGGTGATGGTGTATCTAGAGCATTTTTACGTGCTTTAGTTAA
GTTAATTGGCGGGTATAGGGATGCATTAAAATTTCATCAAGGAGAACGTA
TCACATTTAATAAAGAAGCATTTATCGAATCTAGATCAGCAAATATGCAA
CCATTTTTAAAAAAAATGTTGGAATTGCAGATTTTTCAACAGTTTATAGA
AGAAAGATTAGAAATGTTAAATGCAGGACTTGGATTTTCTGATGAATTTG
AAATGGAAGTTTGTAACTACCATGATAAATCTAGTAATAGATTAAAGCAT
CAGTATAAAGATTGGACATTCACTATGAAACGTGAAGGAACTGCATTATT
TAAAAGTGTGAAGAATGCAGCTAATCCTACAGTAAGAAATGCTGTAAAAA
CGGTTAAAGAACGAGGAAAAGATTTTCGGTTGGTTTACAAAGACATTAGA
TCAAAATTCAATGTTCCAAATAAAAATCCTCGAACCAAAATCAGTACCCA
TCCAAATTCTGCTCCAAACTCTCCTTCAATGCCGAAGAGACAATCTTGGT
CACATACAACAGCATCTGCTAGCTATCGTAAAGAAACTGCCAACGGATTA
CAAAAATTAACTACATCTCAAAATTTTAAAGATGCCTCGATTTCACCGCT
ACCACAAATTAATTTGAACTTAATGGAAGATCTACAAGATGTTATATTCA
GAACTTGTGATAATGATGATCCACAAAATTATACATCATCCTGGGATGAT
TCAGTCAAATCAAATTTTATCATAAATGATGATTTAATAAACTCGTCATT
TGGATCTGTGCCAAGTGAGTGTCCTATGGAAACTAAAGATCTGATTCGGT
TGGATTCAACATCTAGTATAGAAGATTTTGATCCTTTAAATAGTCCAACT
AATAGTAATGGTTTGATTCCAGGAGTAGGTCTTAGTAATCCACTGTATCA
GTATTTTGTTCCATTAAATAAAACTCAATTAGAAACCAAAAACAATAATG
ACCTCCTTAATGAGTATGGATTAAACTTTGATTTGTTAAGTTGTACTGAT
CAACCCGGTCCATCCATGTCACCGAGTCAACCCACTGTACCTCCATTACC
ACCAAAACCACCCAATTTTAAATCAAATTGGACCAAATTTGAATAA
back to top