rna3657 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507637.1
Unique Namerna3657
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:621137..627251 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507637.1
ProductDENN domain-containing protein 1B-like, transcript variant X2
Model evidenceSupporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161284
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507637.1
GeneID107161284
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161284gene2472Diuraphis noxiageneJOTR01000065 621137..627364 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507637.1rna3657Diuraphis noxiapolypeptideJOTR01000065 621415..626958 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363123.1cds3559Diuraphis noxiaCDSJOTR01000065 621415..621822 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31962id31962Diuraphis noxiaexonJOTR01000065 621137..621822 -
id31961id31961Diuraphis noxiaexonJOTR01000065 621885..621999 -
id31960id31960Diuraphis noxiaexonJOTR01000065 622057..622277 -
id31959id31959Diuraphis noxiaexonJOTR01000065 623107..623283 -
id31958id31958Diuraphis noxiaexonJOTR01000065 623403..623630 -
id31957id31957Diuraphis noxiaexonJOTR01000065 624974..625075 -
id31956id31956Diuraphis noxiaexonJOTR01000065 625140..625397 -
id31955id31955Diuraphis noxiaexonJOTR01000065 625981..626034 -
id31954id31954Diuraphis noxiaexonJOTR01000065 626100..626235 -
id31953id31953Diuraphis noxiaexonJOTR01000065 626311..626448 -
id31952id31952Diuraphis noxiaexonJOTR01000065 626507..626665 -
id31951id31951Diuraphis noxiaexonJOTR01000065 626942..627251 -


Sequences
The following sequences are available for this feature:

protein sequence of XM_015507637.1

>rna3657 ID=rna3657|Name=XM_015507637.1|organism=Diuraphis noxia|type=polypeptide|length=671bp
MGSRIRNDVVRLFECFCEVAGPSKENTVPWILQKFPEHYRKDELLGTVPN
FAYPCDFDRTTIQHYSFVLTNAESKWIFGFCRHDPKSETALVVLSYLPWH
ESFYKLLNCISNLTNNNNSKDLWSFLESVYNSKLPIKGLDLKINSDSGEE
LFVCQSPIQFQLPSIPENRNLTEYYSAVDCQNMIIIFASMLFERRIIFTS
KKLYRLSACVQSANAVLYPMNWQHIFIPVLPQSLIDYLLAPMPYLIGLPH
SLFQSLQRNDLGDVVILDADNNTIETPFDDMENLPADVVSTLRRQLRNKG
TLLGDGVSRAFLRALVKLIGGYRDALKFHQGERITFNKEAFIESRSANMQ
PFLKKMLELQIFQQFIEERLEMLNAGLGFSDEFEMEVCNYHDKSSNRLKH
QYKDWTFTMKREGTALFKSVKNAVKERGKDFRLVYKDIRSKFNVPNKNPR
TKISTHPNSAPNSPSMPKRQSWSHTTASASYRKETANGLQKLTTSQNFKD
ASISPLPQINLNLMEDLQDVIFRTCDNDDPQNYTSSWDDSVKSNFIINDD
LINSSFGSVPSECPMETKDLIRLDSTSSIEDFDPLNSPTNSNGLIPGVGL
SNPLYQYFVPLNKTQLETKNNNDLLNEYGLNFDLLSCTDQPGPSMSPSQP
TVPPLPPKPPNFKSNWTKFE.
back to top

mRNA from alignment at JOTR01000065:621137..627251-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3657 ID=rna3657|Name=XM_015507637.1|organism=Diuraphis noxia|type=mRNA|length=6115bp|location=Sequence derived from alignment at JOTR01000065:621137..627251- (Diuraphis noxia)
ATTAGAAAATGTGTAGTAGGAGATGTGTTATCTCTGGTTTAAATTAAAAT GAAACTTTTGAGATTTTGAGTTCCTTAACTCAATATTAAATACTYATTAT TCATCTGCTAACTGCTTATCTAATATTAAAAAAGTTGGACTATTTTGAAA CCTATGTAGTTATAAATTCGTTGGACGTTGGAGACGTGTATCTAATGTTC TGATGTCTTGCTAAACGTTCATATTTTATAATTTATTTACCTATACAGGA ATATTTATATGTTTATTTGTCAATTCATAACAGCTTTGATGGAATGGGGT CACGGATAAGGTGAGCAGTTACAATTTCATTCAATTAATTGTTATATCAT TGATTTAATAAATTTATTTGTCTCCTCTCTCTCTCTCTCTAGTAGTTTAA TATTTTAAGACAATTGTTTTATTGTTAAGTGTGCATTAATTATTGTAGTG TAATATAGYAAATATTTGATATTTCTTTGCCCAAACAGCATTAGATTTTT ATTGAATTACGTTTGTTATAAGTGGTCAGTGCTTATAATTTATGAATTAT ATAGCATGTATATTAATCTTCATTGTATTATACCAGGAATGATGTTGTTC GTTTATTTGAGTGTTTCTGTGAAGTAGCTGGCCCTAGTAAAGAAAACACA GTCCCGTGGATTCTCCAAAAGTTTCCAGAGCACTATAGAAAAGATGAACT GCTCGGCACTGTCCCTAATTTTGCATATCCTTGTGATTTTGACAGGTAGT ATTAAATATTAACTAACAATATCAAACCTTATTCTAATAATTTGAATGTT TAGAACCACGATTCAACACTACTCATTTGTACTGACTAATGCGGAATCGA AGTGGATTTTTGGATTTTGTAGACATGACCCTAAATCTGAGACTGCTTTA GTTGTTCTCAGTTATCTTCCTTGGCATGAATCATTTTATAAGTAAAAACT ATTTAAAATTTACAGAATTTTTTTTTTTCGGGTAATGGAAATGTATCATA CTTGTTTCTGTTTTAGATTATTAAATTGTATATCTAATCTAACAAACAAT AACAATTCTAAAGATCTATGGTCATTTTTGGAATCTGTRTATAATAGTAA GCTACCAATCAAAGGACTTGACTTAAAAATTAATAGTGATAGCGGCGAAG AGGTAATTAATTTACAATACATTTTTAGTAAAGTTTTAAAATATTTCCTT ATTTTAATTTATTATAGTTATTTGTGTGTCAGTCGCCAATTCAATTCCAG TTACCAAGCATTCCAGAAAATGTAAGTAGCTTGCAGCTTAAATTGAACTA TGGTATTCTAACCAATTCTAATGAAGCGTTCCCACGGTGCGTTAATCACG ACAGTGAACCACGCTTTTGTGAAATACACTTCTGTGTGAACGCATAGTCA TTAAACTTTCTTTTGTGAGGAACGGCGCACGACTCAAGCGTGGATAGATC AAACATGTTTGATTTTCAGTCGTGATATACTGTTTGTGAAGCAAAGATGT CGTCACAGCAACRTGGAATTATCGACGGCACGAACCCAACCATGTGAACA TTTCATCAATTCACACTTTCGTGAGTGTCACAAACGAAAGTTGACTAGCG TGGTTGACTATCATGATTAACGCCTCGTGGGAACGCAGCATAATAATTTA TGATTTTAATAATTCATTGAAATAAGCATTATTTATAAATGGTTTAAGTT ACTATTTAGTGCATTATGTACTTATTTATGATAATGTGTAGATTCATATA TCTTAATTTAGTTAAAAAATATAAAAATAAAATCAATAAAACATAAATTA TTTTTTACTGAACTATCAGATTTTCAACTGAAGATTGATTTAAATTTTTT TTAGAGAAATTTGACAGAATATTACAGTGCAGTTGATTGTCAAAATATGA TTATTATATTTGCATCAATGTTATTTGAACGTCGTATTATTTTTACTTCC AAAAAACTATACAGATTGAGTGCCTGTGTTCAATCTGCTAATGCAGTTCT ATATCCAATGAATTGGCAACACATATTTATACCAGTATTACCTCAATCAC TTATTGATTACTTATTAGCACCAATGCCATACTTAATCGGCTTACCTCAC TCATTATTCCAAGTAACTATTTTCTATTATTTAAATTTTGTTTTTGTCAT TTATTACAATTCTTGTTATTTTTTAGAGTTTGCAACGTAATGACTTAGGA GATGTCGTTATTCTAGATGCAGATAATAATACTATAGAAACTCCATTTGA TGATATGGAAAATCTTCCTGCAGATGTTGTCAGTAAATATTTAATAGTAC AACTACCAAACTTATTACTCTATCGAATGTGATATATATGAGTAATCTTA GGCAGCGAAAATATGTATGCATGATAAGTACCGCATTTTCGAAAGCATCA CTTAATTMTTTTAATAACCACCTTGCTTGCATTGCAGTAAGATTAATAAA ACTATAAAAGCGATTTTCAGTTGCCGTTTGGTTTTTAGGAACAAAATTTG ATGTAATCCAGTGGTTTTCAAATCATAATCCATGAGAGTAATCTAGGTGC TCTGTAGACATGTCTAAATTAAATTAAATTAAAATAATATTTTGTTAATT TATCATTAATAAGTATTAACCCACATATTTTGTTTTGTTACTCATACAAC CTCAAGTTATGGATGTCTATGTTTGAACATTTCTAATTTTTAAGGCCTTG TCGAATTTTCTAAGTGCTCAACAAATAAAAAAGTTAAAAATCACTGACAA GCCATTTTTCAAGGGATGGGTATGGTGTGACTGGACTGTATAAAAATTGG TTGCTACTTGAGATTACTCTTATATGAGACAGAATTTAAATGTTTCTGTA CCACTAAATATTTTATTTTTTACGTATTTAAGAGTTTCATTTCAAAGAAT ACAATTAGGATTAAAAACAATCTATTTAATTTTAAACAGATAGTCTTAAA TTATGGTTTTAGTTGTAAAAAAGCTTTAACGCTTAAGAGGACGTGATACC CTCATGTGTTGTCTCCGTGTTACAAGTGCGTAACATACCAAAAACTGTTT CRCGCRGGTAAGAACTGAGAAATCTACAGTTATGAGTTATAACTAAGAAA CCAAATTTTTGCCATGAAAAAAGAAGAATTATTACTTTGTCTCAGCATTT TAATTTTTTCAATAAGACCAATATATCAAAAGATTTTTTAGAGTATAAAT TTTTTCTTATTAAAGATATCAAACAAATAAAAACGCTACGACACAAAAAA TATTATCTTCTATATTATTATTATGTTAACTTTTGTTATTTCTACTAAAA GTACAGACTGAGTGGTTTTATCCTGCGCTAGTTTTTGCAATGTTACGCTG TAAGACGAAGAAAACACATGTGGGTATCACGTCCTCTTAAGTCACTTATT TATTGGTTTGAAAGCTAGTTGGTACTTTAATGACACATTTTTTTCAGTAA ATTCCTTTAGTGTAAATAATATTTATCAATCTGCACTTTATCCTGAGCTT TCAAAGTATTWTTTTAAATGTTATGGTTTATCACTGATTTTGAATTCAAT ATTACAACAAATGTAATTTTCCATTACCTATTGTTATGAGTCATTGGAGA TCTTTTTAATTTTTATTTTAGGTATCAACTTTAAGACGACAGTTACGAAA TAAAGGTACACTCTTAGGTGATGGTGTATCTAGAGCATTTTTACGTGCTT TAGTTAAGTTAATTGGCGGGTATAGGGATGCATTAAAATTTCATCAAGGA GAACGTATCACATTTAATAAAGAAGCATTTATCGAATCTAGATCAGCAAA TATGCAACCATTTTTAAAAAAAATGTTGGAATTGCAGATTTTTCAACAGG TATAGTCATTGTATATGTTCTAAGTAATGATAATTTTTTGTATAATGAAT ATTAGTATTTAGTAATATAATACTTAAAATATATCAATATATCTCAAAAT TAATTATTTTGTTCATAGTTTATAGAAGAAAGATTAGAAATGTTAAATGC AGGACTTGGATTTTCTGATGAATTTGAAATGGAAGTTTGTAACTACCATG ATAAATCTAGTAATAGATTAAAGCATCAGTATAAAGATTGGACATTCACT ATGAAACGTGAAGGAACTGCATTATTTAAAAGTGTGAAGAATGCAGTAAG TTAATAATTTTAAGATTTGTTTTATTGGGGATGTTAGATATTATAATTGC TATCATTTGCCATATTGTTATAACGTAGAGGACATTTTTGATTTACAAAT TATACCGAGCGAACAATTAATATTAAAAATAAAAACCATTTTACGCGTTT TAAAATATTATGCAAAAAAAAAAAAATCATTAAAATAGTTTTTTATATTA AGATACTAATGTAAATTTTAATGTTATATCAAATTCTTATTTATAATTTA ATCAGTATAATATAAAATATTTTAGGTTTTATACCTTGTTTCAAAAGAGA ATACACCAGGCTGCGACCAGTTTCCGCCGGTGGTGCGCACCATGGGTAAT GACTGGTAGAAGAAGAAAACAGTTGGCTGAACTACTATATTCTCTTTTGA AATAAAGTATAGTTGATAAAATGAAATAAAAAATAAATAAATGAAATATT CCAAAAATATTATTTTGAGACTTATCATAAAATTTATAAATTTACCAACT TTAAAATGTTTCCTGGATGTATCTAATTTTTTTTTAAATCTTATTGGACT TACTTGATAACAGCATACAGTAGGTATTTTTATTTTGTATTTAATAGAAT ATGAATCTTAATAAACAAATTTTTGGACTTATAATTTTTGTGAGGTAATT TATGATTAGTTAAATTTTTAATTACAAATATTTTCTTAGAAATCATTAAA CTAATCATATTATAACATTTTCATTGTTAATTTTCAGGCTAATCCTACAG TAAGAAATGCTGTAAAAACGGTAAATTAGTTTCATGTAAAAATAAAACTT TTATATCATATGATACGTTTTTAGGTTAAAGAACGAGGAAAAGATTTTCG GTTGGTTTACAAAGACATTAGATCAAAATTCAATGTTCCAAATAAAAATC CTCGAACCAAAATCAGTACCCATCCAAATTCTGCTCCAAACTCTCCTTCA ATGCCGAAGAGACAATCTTGGTCACATACAACAGCATCTGCTAGCTATCG TAAAGAAACTGCCAACGGATTACAAAAATTAACTACATCTCAAAAGTAAA CAAATATTTATTCGCTATTATTACAGTTTTACCAAATATCTATTTTTCAT AGTTTTAAAGATGCCTCGATTTCACCGCTACCACAAATTAATTTGAACTT AATGGAAGATCTACAAGATGTTATATTCAGAACTTGTGATAATGATGATC CACAAAATTATACATCAGTATGTTGAAAAAAATTAACAATTTTTAATTCT TGAGAATTAATAAAATATTTTGTGTTTAGTCCTGGGATGATTCAGTCAAA TCAAATTTTATCATAAATGATGATTTAATAAACTCGTCATTTGGATCTGT GCCAAGTGAGTGTCCTATGGAAACTAAAGATCTGATTCGGTTGGATTCAA CATCTAGTATAGAAGATTTTGATCCTTTAAATAGTCCAACTAATAGTAAT GGTTTGATTCCAGGAGTAGGTCTTAGTAATCCACTGTATCAGTATTTTGT TCCATTAAATAAAACTCAATTAGAAACCAAAAACAATAATGACCTCCTTA ATGAGTATGGATTAAACTTTGATTTGTTAAGTTGTACTGATCAACCCGGT CCATCCATGTCACCGAGTCAACCCACTGTACCTCCATTACCACCAAAACC ACCCAATTTTAAATCAAATTGGACCAAATTTGAATAAAATTACAAATCTA GAATTTATAATTTTAAAATACTTGTGATAAAAAYATTTTATTTTGCAATC ACACTACTTTTAAGCTAGTGGTTACCACTTATATTAAATATTTTACAACA TTGTCCATGTTTACATTTTATCAACATTTTTTTATATACTCATATATTAT TGTTACACCAAATATTAACAAATGGACCAGAATGTTGTGTCTGATTTAGA TTGTTTAACGCTCATAAATGTAGTTGTATATTACATGTTATACATGGTAA AAATTGTATGTTTAT
back to top

Coding sequence (CDS) from alignment at JOTR01000065:621137..627251-

>rna3657 ID=rna3657|Name=XM_015507637.1|organism=Diuraphis noxia|type=CDS|length=2013bp|location=Sequence derived from alignment at JOTR01000065:621137..627251- (Diuraphis noxia)
ATGGGGTCACGGATAAGGAATGATGTTGTTCGTTTATTTGAGTGTTTCTG
TGAAGTAGCTGGCCCTAGTAAAGAAAACACAGTCCCGTGGATTCTCCAAA
AGTTTCCAGAGCACTATAGAAAAGATGAACTGCTCGGCACTGTCCCTAAT
TTTGCATATCCTTGTGATTTTGACAGAACCACGATTCAACACTACTCATT
TGTACTGACTAATGCGGAATCGAAGTGGATTTTTGGATTTTGTAGACATG
ACCCTAAATCTGAGACTGCTTTAGTTGTTCTCAGTTATCTTCCTTGGCAT
GAATCATTTTATAAATTATTAAATTGTATATCTAATCTAACAAACAATAA
CAATTCTAAAGATCTATGGTCATTTTTGGAATCTGTRTATAATAGTAAGC
TACCAATCAAAGGACTTGACTTAAAAATTAATAGTGATAGCGGCGAAGAG
TTATTTGTGTGTCAGTCGCCAATTCAATTCCAGTTACCAAGCATTCCAGA
AAATAGAAATTTGACAGAATATTACAGTGCAGTTGATTGTCAAAATATGA
TTATTATATTTGCATCAATGTTATTTGAACGTCGTATTATTTTTACTTCC
AAAAAACTATACAGATTGAGTGCCTGTGTTCAATCTGCTAATGCAGTTCT
ATATCCAATGAATTGGCAACACATATTTATACCAGTATTACCTCAATCAC
TTATTGATTACTTATTAGCACCAATGCCATACTTAATCGGCTTACCTCAC
TCATTATTCCAAAGTTTGCAACGTAATGACTTAGGAGATGTCGTTATTCT
AGATGCAGATAATAATACTATAGAAACTCCATTTGATGATATGGAAAATC
TTCCTGCAGATGTTGTATCAACTTTAAGACGACAGTTACGAAATAAAGGT
ACACTCTTAGGTGATGGTGTATCTAGAGCATTTTTACGTGCTTTAGTTAA
GTTAATTGGCGGGTATAGGGATGCATTAAAATTTCATCAAGGAGAACGTA
TCACATTTAATAAAGAAGCATTTATCGAATCTAGATCAGCAAATATGCAA
CCATTTTTAAAAAAAATGTTGGAATTGCAGATTTTTCAACAGTTTATAGA
AGAAAGATTAGAAATGTTAAATGCAGGACTTGGATTTTCTGATGAATTTG
AAATGGAAGTTTGTAACTACCATGATAAATCTAGTAATAGATTAAAGCAT
CAGTATAAAGATTGGACATTCACTATGAAACGTGAAGGAACTGCATTATT
TAAAAGTGTGAAGAATGCAGTTAAAGAACGAGGAAAAGATTTTCGGTTGG
TTTACAAAGACATTAGATCAAAATTCAATGTTCCAAATAAAAATCCTCGA
ACCAAAATCAGTACCCATCCAAATTCTGCTCCAAACTCTCCTTCAATGCC
GAAGAGACAATCTTGGTCACATACAACAGCATCTGCTAGCTATCGTAAAG
AAACTGCCAACGGATTACAAAAATTAACTACATCTCAAAATTTTAAAGAT
GCCTCGATTTCACCGCTACCACAAATTAATTTGAACTTAATGGAAGATCT
ACAAGATGTTATATTCAGAACTTGTGATAATGATGATCCACAAAATTATA
CATCATCCTGGGATGATTCAGTCAAATCAAATTTTATCATAAATGATGAT
TTAATAAACTCGTCATTTGGATCTGTGCCAAGTGAGTGTCCTATGGAAAC
TAAAGATCTGATTCGGTTGGATTCAACATCTAGTATAGAAGATTTTGATC
CTTTAAATAGTCCAACTAATAGTAATGGTTTGATTCCAGGAGTAGGTCTT
AGTAATCCACTGTATCAGTATTTTGTTCCATTAAATAAAACTCAATTAGA
AACCAAAAACAATAATGACCTCCTTAATGAGTATGGATTAAACTTTGATT
TGTTAAGTTGTACTGATCAACCCGGTCCATCCATGTCACCGAGTCAACCC
ACTGTACCTCCATTACCACCAAAACCACCCAATTTTAAATCAAATTGGAC
CAAATTTGAATAA
back to top