rna3658 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507638.1
Unique Namerna3658
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:627517..631719 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507638.1
ProductBTB/POZ domain-containing protein 10
Model evidenceSupporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161285
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507638.1
GeneID107161285
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161285gene2473Diuraphis noxiageneJOTR01000065 627517..631719 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507638.1rna3658Diuraphis noxiapolypeptideJOTR01000065 627836..631576 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id31963id31963Diuraphis noxiaexonJOTR01000065 627517..627734 +
id31964id31964Diuraphis noxiaexonJOTR01000065 627828..627942 +
id31965id31965Diuraphis noxiaexonJOTR01000065 628235..628345 +
id31966id31966Diuraphis noxiaexonJOTR01000065 628951..629181 +
id31967id31967Diuraphis noxiaexonJOTR01000065 629240..629454 +
id31968id31968Diuraphis noxiaexonJOTR01000065 629510..629707 +
id31969id31969Diuraphis noxiaexonJOTR01000065 630898..631145 +
id31970id31970Diuraphis noxiaexonJOTR01000065 631355..631719 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363124.1cds3561Diuraphis noxiaCDSJOTR01000065 631355..631576 +


Sequences
The following sequences are available for this feature:

protein sequence of XM_015507638.1

>rna3658 ID=rna3658|Name=XM_015507638.1|organism=Diuraphis noxia|type=polypeptide|length=444bp
MSKDXRHNYDRDTSSDTEDYQDTEDHRRRVFKTRLSYGSSLKPKSCLVQR
HSTGNQLTLTPINKQQTTSVRNRKAMSRFPCSMNSMKSLMNQNATASGSS
YPSTSGSGHLNSSRNNIANKEERVTLIVDNTRFIVDPAIFIAHSNTMLGR
MFSSNEYTNKNERGEYVVAEGVSANVFRCILEYYKGNVMRCPSSISVQEL
REACDYLLIPFDAKTVKCQNLRGLLHELSNEGARCQFEVFLEDLILPLMV
NSAQRGDRECHVVVLLDDDVVDWDEEYPPQMGEEYSQTVNSTALYRFFKY
IENRDVAKQVMKERGLKKIRLGIEGYPTYKEKVKKRAGGRKDVIYNYVQR
PFIHMSWEKEEAKSRHVDFQCLKSKSVTNLAEATADPVLELDARGNPMGA
VAIDPEIQVVYDGHDQDDGAVDSPPPPAVSETEQNDEPQPNEQ.
back to top

mRNA from alignment at JOTR01000065:627517..631719+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3658 ID=rna3658|Name=XM_015507638.1|organism=Diuraphis noxia|type=mRNA|length=4203bp|location=Sequence derived from alignment at JOTR01000065:627517..631719+ (Diuraphis noxia)
AGTGGCCACATTGTTGATAGGTTCTAGTTAGTATCGTCTCTTAAATTGTG TTAACAGAAATTAACTtcaacaatttacaatattgcaTTGGCATGTTGAA AGTTGTAAATGRTTCGGCAATCAGcatttgttttcatttacaTTAGGCAG TAGGTGCTAGGTTTCATTGACGTTAGATATTTTACTAGTGGTTGGTGCCT GTTCATGGGTAAAACAATGTATGTTTTTGttgtcgtatattattattaag ttatttgtcTGCCCAAATTTAGATCGTTGAACttgttattaaacttattt gttttatctaGCCTGGGTCATGTCTAAAGACGKCCGTCACAACTACGATC GTGATACAAGTAGTGACACAGAAGATTATCAAGATACTGAGGATCATAGA CGCCGTGTGTTCAAAACAAGACTAAGGTATATTTTTGTCAAACATAGTAC TATTTGTTATTGccatttgtattattatgataaaagttcTAGAAATAAGT TGTAAATTGGTCCATGAGCTATTGTTTAGCAAAATATTTGTTCATccaca tcaatataatattatactttatgataAATGTTCTTCAACAATGAATTATG AACTAAGATCtagtttaaaatgattttcacTAGTTATAAAGTAACATAGt ttctattgattttataaattgtaatagataatgttttagtattttagtct tgaatttttgtatttcagtTATGGAAGTTCCTTAAAACCCAAATCGTGTT TGGTACAACGTCATTCAACTGGTAACCAGTTGACTCTGACACCAATCAAT AAACAACAAACAACTTCAGTGAgaaataggtaaattataatggtttagat ggtaatttattgaattgttatttattataataaatttattgatggaTCCT GTTTGTACTGAaacagcatacatttttttttgtacctatcattaaaataa atgatttatttttaattttaaactaattaaatatatttgcataCATAACT CATTGCATTAAAACTAGGATTTTTCAAGCAAACTTTAAAGGGTAGAAACT AACACAACTAGTTCAGGATTGTTGGACTATTATTTTAgctataaactaat aataatcaaaactaGTTATTAGTAactaaaatgtatcaattatcATCACA GTAATTAGTTtcgtaaatttgtattttgtattaaattaaggTTATAAAAA TCTGTTTGAAAATAACTGACTGatgattaatatgtaatttgatTACTGTT GACCCCTAATCACTTTTGTCTTTACTGGTACCCTTACCTGTATTTTTtac tactaataattaaaactttatttagtATAATCTTAAAACTTTCTCTTTTA AGCTTTCStattaataaataataatttattattcttaaattattttatat aacatatattttatgtatacattatttctaATAGAAAAGCTATGTCCAGA TTTCCTTGCTCAATGAATTCTATGAAAAGTCTGATGAATCAAAACGCAAC TGCTTCAGGTTCATCCTATCCAAGTACTTCAGGTTCAGGCCATTTAAATA GTTCTAGAAACAATATTGCTAATAAAGAAGAAAGAGTAACTCTTATTGTA GATAATACTAGATTTATTGTTGATCCTGCTATATTCATTGCCCATTCAAA TACAATGCTTGgaaggtaataaaaaataaattcatgttctaaacattgtt tttataattatacttttttacagAATGTTTAGTTCTAACGAATATACAAA TAAGAATGAGCGTGGAGAATATGTGGTAGCAGAAGGTGTCTCAGCAAATG TATTCAGGTGTATTTTGGAGTATTATAAGGGTAATGTAATGCGCTGTCCA TCTTCAATTTCAGTACAAGAGCTACGAGAAGCTTGTGATTATTTGTTAAT ACCATTTGATGCTAAAACAGTTAAATGTCAAAATTTACGTAAGTAACTAA TGTATTTAAGTAAGttgtatatattcaaatttgataATTGTAGGAGGATT ATTACATGAGTTGTCAAATGAAGGAGCTCGTTGTCAGTTTGAAGTATTTT TAGAAGATCTAATATTACCCTTAATGGTAAATTCTGCTCAACGAGGAGAT CGTGAATGTCATGTGGTCGTCTTACTTGATGACGATGTAGTAGATTGGGA TGAAGAATATCCGCCTCAAATGGGAGAAGAATATTCACAAAGTAAAACCA Aagattaaattcatataaaaaatatttcaaacttaaaacattgattttat aatatatagataagcCATTCTATTTTTAAGTGGTAACGGCTAATTGCATT CAACTGTTAGACGTCACTGCGTTCGATTGCATTTAAAAGGGGTAAACATA TGATGGATGCTGTATGgcttatctgtatattataaaatcaatgcttAAAA TGATTTCATATTAACTTGAGGTACATTGGAGTCATATACGTACTCAGGAA TTTTCAATGGTGGGGGGGAgggattgaacattttttttatcacggggact ttgtcaaatttttttttagaaaattgcttCTTTGAATTATATTAKTTATA AGCAAAAATGCACAAAAGTGCATCGGTTAGTGAGGCCATGCGGGGTTCAA ACCCTACGAATCCCGCTATGCCCCTGATTGGAgtcataatatactaataa ctaataagtaataacaaagtggtttaaattaattttagggtAGGTTAACC TTAGTAAATTTTTAGGTTTTGAAGAAAacgtaatgaatgtattgataata tagtttacaatgatattgttttttttatgtttatagacatatgttataaa ataatattattttatttatttgcttttattttaaacttcaatatCTTTTC TGGTAGGAAAATCAAACTAATTAGTTCCTTGTGAGTTGTGACTTATTAGA AACTCACCACTCAGAATTGTTTGTgtatgcaataatttttttaattcaac caTTATAGTGGTCAGTGACCTTCTCAATGATGAGGTACATTTAACTGCTA CTTGTACATCCTTTTGATYATAAATAATGGATAGAGCTACTACCTAAATA CTTGAAGCCAATATACCAAAGGAAAATTGGGGCAAATATGCATGCGGGAA ATCTATATCACACATTCATATACAACYTAGattatatgcaatttatatCA CAGCTTATTAAGTGATATACATGATCAATGTGCAACTAGTACTGATATGT ATGCAATATGCATCATAGAAATCAGTCCTCTTGCGATCATCAATAATGAT GCCTTCAACACATAGTATGTGGTTATAATACAGAAGCTTTATCCAAAGTG TATGATCTAAAGTATAGCCTAACTGTTTCCTAATTACCAACTTTTTATTA CAACATTCAAATTCATCGATTTTTATTTCAGCTGTAAACAGCACTGCCTT ATATAGATTCTTcaaatacattgaaaatagaGATGTTGCCAAACAAGTAA TGAAAGAGCGTGGTCTTAAAAAGATTCGTCTAGGCATTGAAGGTTACCCA ACTTATAAAGAAAAAGTCAAAAAAAGAGCTGGAGGTCGTAAAGAtgtgat ttataattatgttcaaAGACCTTTTATTCATATGTCATGGGAAAAAGAAG AAGCTAAGAGTCGTCATGTAGATTTCCAAGTAAATTTTGGTCTTAccatt tattcattaaaatatattcctcCTGCATGTATTCCAGTAGATAATGTTat gtaactttttaaaaaaatagaggagaatttaatttcttattgtatataaa tattatatttcattatcaacttaacattaaaatatttagatttaaatcgA TTATTTCCTGTTACTAATcactatttattactatttagtgCTTAAAGTCC AAGTCTGTGACTAATTTAGCAGAAGCAACTGCTGATCCTGTTTTGGAGTT GGATGCTAGAGGTAATCCTATGGGTGCTGTTGCCATAGATCCAGAGATTC AAGTTGTATATGACGGCCATGATCAAGATGATGGAGCTGTAGACTCTCCT CCTCCTCCCGCAGTTTCAGAAACTGAACAAAATGATGAGCCTCAGCCCAA TGAACAGTAAAATACATTGggatttatacataggtacagtgtttttttta ttgttactgaACAATCAAGTGGTGAttttctctatatttttttccaacaa gcattttactactattattattaataaatgcgtCTTTTTCTAatgtcata tat
back to top

Coding sequence (CDS) from alignment at JOTR01000065:627517..631719+

>rna3658 ID=rna3658|Name=XM_015507638.1|organism=Diuraphis noxia|type=CDS|length=1332bp|location=Sequence derived from alignment at JOTR01000065:627517..631719+ (Diuraphis noxia)
tgCTTAAAGTCCAAGTCTGTGACTAATTTAGCAGAAGCAACTGCTGATCC
TGTTTTGGAGTTGGATGCTAGAGGTAATCCTATGGGTGCTGTTGCCATAG
ATCCAGAGATTCAAGTTGTATATGACGGCCATGATCAAGATGATGGAGCT
GTAGACTCTCCTCCTCCTCCCGCAGTTTCAGAAACTGAACAAAATGATGA
GCCTCAGCCCAATGAACAGTAACTGTAAACAGCACTGCCTTATATAGATT
CTTcaaatacattgaaaatagaGATGTTGCCAAACAAGTAATGAAAGAGC
GTGGTCTTAAAAAGATTCGTCTAGGCATTGAAGGTTACCCAACTTATAAA
GAAAAAGTCAAAAAAAGAGCTGGAGGTCGTAAAGAtgtgatttataatta
tgttcaaAGACCTTTTATTCATATGTCATGGGAAAAAGAAGAAGCTAAGA
GTCGTCATGTAGATTTCCAAGAGGATTATTACATGAGTTGTCAAATGAAG
GAGCTCGTTGTCAGTTTGAAGTATTTTTAGAAGATCTAATATTACCCTTA
ATGGTAAATTCTGCTCAACGAGGAGATCGTGAATGTCATGTGGTCGTCTT
ACTTGATGACGATGTAGTAGATTGGGATGAAGAATATCCGCCTCAAATGG
GAGAAGAATATTCACAAAAATGTTTAGTTCTAACGAATATACAAATAAGA
ATGAGCGTGGAGAATATGTGGTAGCAGAAGGTGTCTCAGCAAATGTATTC
AGGTGTATTTTGGAGTATTATAAGGGTAATGTAATGCGCTGTCCATCTTC
AATTTCAGTACAAGAGCTACGAGAAGCTTGTGATTATTTGTTAATACCAT
TTGATGCTAAAACAGTTAAATGTCAAAATTTACAAAAGCTATGTCCAGAT
TTCCTTGCTCAATGAATTCTATGAAAAGTCTGATGAATCAAAACGCAACT
GCTTCAGGTTCATCCTATCCAAGTACTTCAGGTTCAGGCCATTTAAATAG
TTCTAGAAACAATATTGCTAATAAAGAAGAAAGAGTAACTCTTATTGTAG
ATAATACTAGATTTATTGTTGATCCTGCTATATTCATTGCCCATTCAAAT
ACAATGCTTGgaagtTATGGAAGTTCCTTAAAACCCAAATCGTGTTTGGT
ACAACGTCATTCAACTGGTAACCAGTTGACTCTGACACCAATCAATAAAC
AACAAACAACTTCAGTGAgaaatagATGTCTAAAGACGKCCGTCACAACT
ACGATCGTGATACAAGTAGTGACACAGAAGATTATCAAGATACTGAGGAT
CATAGACGCCGTGTGTTCAAAACAAGACTAAG
back to top