rna3663 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507633.1
Unique Namerna3663
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:637477..652498 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507633.1
ProductPHD finger protein rhinoceros, transcript variant X2
Model evidenceSupporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161283
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507633.1
GeneID107161283
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161283gene2475Diuraphis noxiageneJOTR01000065 637477..652498 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507633.1rna3663Diuraphis noxiapolypeptideJOTR01000065 642734..652114 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32004id32004Diuraphis noxiaexonJOTR01000065 637477..637773 +
id32005id32005Diuraphis noxiaexonJOTR01000065 638211..638329 +
id32006id32006Diuraphis noxiaexonJOTR01000065 642682..642782 +
id32007id32007Diuraphis noxiaexonJOTR01000065 642842..642990 +
id32008id32008Diuraphis noxiaexonJOTR01000065 643064..643314 +
id32009id32009Diuraphis noxiaexonJOTR01000065 643374..643537 +
id32010id32010Diuraphis noxiaexonJOTR01000065 643599..643747 +
id32011id32011Diuraphis noxiaexonJOTR01000065 645446..645733 +
id32012id32012Diuraphis noxiaexonJOTR01000065 645804..645977 +
id32013id32013Diuraphis noxiaexonJOTR01000065 646059..646186 +
id32014id32014Diuraphis noxiaexonJOTR01000065 646249..646495 +
id32015id32015Diuraphis noxiaexonJOTR01000065 646583..652498 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363119.1cds3565Diuraphis noxiaCDSJOTR01000065 646583..652114 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3663 ID=rna3663|Name=XM_015507633.1|organism=Diuraphis noxia|type=mRNA|length=7983bp|location=Sequence derived from alignment at JOTR01000065:637477..652498+ (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
tgtacctatatcgcCAATCGCTACTCGCAAGTGTCGAGCATGAAACGATA
AGTGCGAAATTCGTACCGCTCGCATTTTGGTGTTTTCGTACACCGTTTTT
ACCGCCGCTGTTTGGACGTTCGCCGTCGCGTATTCGTCGCCGTGACCGTT
CGTCCGCTAGTGGATATCGCCGCCATCGTCCATTGAACCGCGCTCTCGCC
CGACCTGTACCGCCGCCGATGTAAACGGGCCCCCCCGACCAAATGTGTTG
GACGTGTTGAGAGCTGTTTGAGATTACCTAGTTGGTGTTACACTCATTGA
TTGTCAGTCGCCAGATGACGTCCCGTGTTTCAACTGCAATGGAATGCACT
AGTATTGGTACAGTCCCAACCTGTTTGGCGCTTGAAAATTGATTTctgca
atacaatatatacctggCATCAATGCTGCAGAAGGCGGAGTTAGGTTTTT
ATCATTTGCAAACTCAGCATGTCATATAGAACTAAACGTCAACCAATTTC
TAAAGATGAATGTCCATtaccgACAAAGAGGCGGAAGGGGCGCCCTTCGA
CGCTACAGGAAGAAGAAGAAGCGTCCTCTTTAGATACTCAAAGTGGCTCG
CGTTCAGATATGAAAATACCAtcatcaatttataatacaagaaTAACAAC
TGATGCACCAGCAGAATTATTTCGTAAAGACTTGATCAGTGCCATGAAGC
TTCCTGATTCTGAACAGTTATCTACTGATGCATATTGGATTATTAGTGAC
CAATGGAAACAAGAATGGGAACGGGGTGTGCAAGTACCTGTTAATCCAGA
CTCTTTGCCTGGGTCAAGTGTTCATGAAATTCCAGTTGTCTGCTTACAGT
CTTCAACTAAATCACCTAGGCGTTCACCATCATCAATTTATCACTCTCAA
CATAATGAATTTAAactgccaaaacataaatatattcgCATCACTAAAGA
CGAACATTTTAAATCCGAAGAACATCAACTGTCACTCTTACCTTTAAAAG
CTGAAAAATCTTGTTCATATGATATGGATGATGTAGATACAGCTTGGTTA
AAACTGTGTAATGGTGAAAGAACATTAGGAGgctTCCCAAAAATAAAAGA
TGATCAATTTGAGCGTGTTATGGAAGAATTAGAAATGAGGTGTTGGGAAA
AAGTGCAAACAATAATCAAGGAAGAAGAAGGCCTTGGAATCGAATACGAT
GAGAATGTAATCTGCGATGTATGCCGTTCGccTGATTCAGAAGATGGTAA
TGAAATGGTGTTTTGTGATAATTGCAATATTTGTGTTCATCAAGCGTGTT
ATGGTATTACCACAATCCCATCTGGGTCTTGGCTATGTCGTACTTGTACT
TTACGTTTTCGTCCTGAATGTGTACTTTGTCCAAATAAAAATGGTGCAAT
GAAATGCACACGGTCAGGTCATAAATGGGCRCATGTGTCATGTGCATTGT
GGATACCAGAAGTTAGCATTGGATGTGTAGAAAAAATGGAACCTATTACC
AAAATATCAAGTATACCTccTAGTCGATGGGCTcttatatgtgtattgtg
tcgAGAACGAGTCGGAGCATGTATACAGTGTTCAGTTAAAACATGCAAGA
CTGCATATCATGTTACTTGTGCTTTTAAGCACGGTCTTGAAATGAGAGCT
ATTATTGAAGATGAGAGTGCTGAAGATGGAGTTAAATTACGGTCATACTG
TCAAAAACATAGTGTAACTAGTAAAAAAGATAGAAATTCTGGTTCAGAAG
ATGAAGATTCTACAAAAAGGAAACGAAAAGATATGACTtctgaagaaaaa
aatcaaGCTAGAGCGGCCAAGCTGCAAGAAATTGAAGGCGAATTTGAAAA
GCATGTCAGTGTCATTGATGTTACACAATGTCGTGATGTTGATAATGATg
gtattctatatatttataattattgggtATTAAAAAGAAGATCTGGAAAT
AACAGACCTTTGTTATTACCAAAATCTGATGATGGTGATCTTCTTGGAAG
ACAACAAGAACAAGCagatttagaaaaacataaaatgtttgtacaactTA
GACAAGATTTAGAAAGGGTACGGAATTTGTGCTACATGGTCAGCAGAAGA
GAAAAGCTTTCTCGTAATTTACTCAGCTTACGTGAGCAAACTTTTCATAA
ACAAGTTGCAGTTCTTACAGATAACAAGCTTAATCTTAGTTCAGCAGAAG
TTTCAGCCRTCCAGGAAGCTAATCATGGGCCATCAATATATGATCGATTG
TATTCGTATCCTGATGCTCCAGACTTGAGCACTGATTTTGAAACTATGTT
ATCTCGTATTGCTGGAGATGGTTCTCCAGAAAAATCCAATTATACTGGTT
TAAAGTGGCCTCAAAGTAATAATCCATATAAACGGTCATATATTAATGGA
TCTATACGATACTCGAGTATGTCAAGCAGTAGTGATCTTGAACTAAAACC
TCCTAGACTAATTAGTAGTGAACGATCAAGTATGGATGAAGctgaattaa
ttaaatctatgtTGAATAAAcgtaaattaaaagaaaaaaggcTTAATAAA
AAACgttcaaaaacaaaactttCTACTGATTCATCTACTGAAGAAGAAAA
TGATAAAGTTAAACAAAAATGGAATGTATCRcctaataaaaaattgttac
aaattGAAAAGCAATTTGGTAGTGATGATAGTGAAGATGTTTCCTTACCA
AAACTTTCATCTAAACGTCCAactaaagttaataatatctattctgACTC
AGATTCTGAAGTGTCAACCAAAGATGATAGTCTCTCGTACACACACACTA
AAGCAGCAGTTAAAGAGTTCTCTCAAGGAAAGTCTAAAACTAAAGTTCTT
AAAGATAAAAGTACTTCTGTTTCTAAAACTAAAGAATCACTAGAGAagga
tactaaaaaaattaaaaaagatgatcctaaaaataatactacagTGCCTA
CAGAACTTATTGTTCCTCAAAGACAAGCTGCTAAGAAAGCTACTGAAAGT
ATTCATCGGGTACATAATAAACATGATGAAATTTCAAATGAAAAGAAATC
TCCAGAAAAACTATTTTCATCACATAGAAAATCTCCTGAAAGGGTTTCAT
CTAATACTAAATCACCAGATAAACAACctattaaagttaataaaattaaa
aacgctgAAAAATTAAGTTCAGTAGAAAAAGAATCTGATCTACAAGATTC
ATTTAGTATTGTTCCACAGAGGCAGGCTGCTAAAAAAGCCATTCAAGGCA
TTAAGAGTGGTATGACAAAACCTGTTGAAGAAACTAAAGTATCTGAACCT
GTTAAAAAAGACGATTCAACTACCAAGTCGAAACGTAGTGCAAAGTCTTC
TTTATCCTCTACATCGAGTAGTAGTTCTTCTAGTAGTTCATCAAGTACTT
CAAGTACTTCTAGTTCTTCTTCTTCATCAGGTTCGTCTACTTCTGAAAGT
GATACAGAACCAGAAAAGAAGAATAAATCTATTGATCGTGTAAGTCCACC
AAAAGAAATTAGTAAAACTAAAAGCCCTCCTAAAGCTAAAGGTTGGTTAT
CAGAGAATAAGCCTATTAAAATTAGTTCCTCCTCTAGTAGTGAGTCTGAT
AAAGACCAGAAAGTGATCAGGGCGCCAGACAAGAAGCTTAAAACTTCCGA
CAGGCGGCCTGAACACAGGTTTCAGGATCCGCCACCTAAGAGAGAGGAAT
CTAGAAGAAAATCGATTGGAAGTGATCGATGCGATTCTGTTCAAATCGTC
ACATGTGGAGATTCTAGTATCGGGGATGATGGAAATAGAAAATCGAGCGA
TAGTGACAACGTTGGAACATCAACTAGTCAGCCGGACGGAATTAAACAAG
AAACGAAACAGCCCATACATGCAGTTGAGGACAAAGAGGTTGAGAAGAAG
TTGAAACTTGATGATGGTGATCAGAGAGTTCTCAAAGAAGACCATGGcct
taacaaaaatattcaagaagtgaaaaataaaaatgtaactccCGTACAAC
ATACATCTGataaagaaaataagaaaaccgATGAATTAAACTTGTATTTA
CCAGGTGGTCATCGTTTAAATGATCTCAAAGACGAAAATTTATTAAGCTC
TTCATTTCTAACCAGACAAGACATAGAACGagaattagttaataatattg
attatgataataagAAATACTCTAAAATGYCGTTCAACtgtaataatcat
ttttctGGAAGTCAAAGATCAATTTTTTCTCCACAACAATGTAATAAAGA
TATTCCAGATTTTGACTTTGATAATGATATGTTAGCTGTTGAACAAGCTG
CAAATGAAGAAGGATTTGGGTTAACAAGAGACACAGATGTTCGAAATGCT
CCATTATCTTTTACATTCAACAATGAGTTCCTCTTCAAAGATGATTCAAA
AGAAATTACAGCTAGAGAAACATTAAACCTTGTTGAAAAGTTGAGATTAG
GAATCACCAAAAAAACTGTACCGTTAGAAAATGAGaacatagaaaatatt
gaattaaacgaTACTCCTAAAATACTTGATCCACCTAAACCATCTGAACC
AGAACAAAAGACAGACAATATTCTGTATAATGCATACAACAAATTCCATC
AACAGTCCAATGATGTAGTAGATGTGAATAAAGTTCCAGAACGAGATAAA
TTGGATAGGAGTGAAAGTGCTTTATCTGACGAGAGGTGGGTACCACCTAG
TCAACGTAGTCAGGCAGAATCTCCTTATCAGGATATTAATGATGCCAACC
GTTGGTCAGATAGCGTTGTGATGCCATCTAGACGTTCAGATACCTCCAAT
GAACCATCTCCAGAACATCAAAATCCACCTACAACAGAgtcattatatca
aaatatacactCGTTTCCTACATCTGTTCCAATGCAAATAGAAAGTATGC
AGTTTCCTCAGTTTTCAGAACCATCATTTGTATTGAACCCACCTTCTAGT
AATCAGTTGTCTTTTATGTCTTCTTCGCGGAATTTTAATCCTCAACAATT
TGCAATACCTCCACCATTCTCAGCTCATCAAAATTTGATGCCAGAGTTGA
ATAAACCATTACATTTGCAGCAAACTCCTTGTACAGCAGCCTTCACTTCA
TCAACTCAAAATATGGCATTTACTGCAGCCATGATATCTCCAATGACACA
TCACGATAATTTTATTCCACCGTTTAAtgatataagtatgtataatgATA
GCAATCTTTTAATGGGTCCTAGTACTAATAATTCATCTTTACATTCAGAA
TCTGTCATGCATACTGTATTCAATGCAATTAATCAAGCATCTATGATTGA
TAATCAACTATCTATTTTACCAACAATTCAAACTCCTAAAACTCCTAAAG
TCTCTACCAGTAATCAAATTTCTGGTAGTCATRATCTAATCCCAGCTTCA
ACAAATAACCAAACCcaagaaattaatttacaatcaaCCTCAAATCAACA
CCAAGTACCAGTAACTTCTAATAATCAAACTGAAATAACTCTTTCACAAT
CAATTTCAAACAATCAAGAACCTGTTTTTAgtcaaagtaaaattaatagt
gAACAAGTAACGCCCAAGAATCAATTAGCAGCACCAATATCAAACCAAAT
ACCATTGAATAAACAACAATCGATTCCAGAAGTACATACACCGTTAGTAT
GTCAAGCAGAAGTTAGTCAACAAAACATCATTAATCAAACACCAGTGCAG
ACCCCTATCAGTGTCAGTCAAGTATCTAATCAAACTACTCCAAGTATACC
AACTCCTAAACAATCACCTGCTCTTCCTACAACTCCTTTGCCAGAACGAT
CACCAATGTCAATTATTGCTTCATCTCCTTCTGTGACTAGTTCACCACAT
CCTAATCGCACACCTTCTGATAAAAAATCTCCTTCTAAACCTACTCGATC
TTCAAGTCGTGTTACTGCTCAATCTTATAAATCACCTGAAATAGTTGATC
ATTCACCAGAAGTTAAAAAACAGAATAAACGAGGACCAAAACCTCAATCC
AAAACTTCTGGACGTGGTCGAGGTCGTGGGCGTGGGCGTTCATCGAATCA
TTTTACTGATTATAATCCTGCTGTTAGTAAGCTTGCTGGTACTGCTTATG
ATCTTGATTTTGTCGAAGAATttggtaatgataataatggtgTTATGGAG
AATCTTCGAGCAATGCGTGAACGTAAAAAGTCTGATGTTAAAGCTGATAG
TAAATCACCTGTATCTCCTAAAGTACATAGCAGCCCTAATAACTATAGAA
GAAAACATGCTAGTATAAAAGAACTTAAACCTCCTTCCCCCATCACGGAA
ACTCCTATTGAAGATCCACCAGCTCAAATAATAATGGATGAACTGACTCC
TATGTTACCTGCGCCCGTTGATATGAGAACATATGATTCATACGATAATA
CAACATCATATTCTGATAACATTTATGAAACCAACACTAATGTTGATGAT
AAAGTAACTGATATTGTGAATACCTTAAAAGAAGActtacataatttttc
aaaattatcttCCAAAGATAAAGATATTGAAGAtcagttaattttaattg
atgacCAGATCAAGATAATTAAATTACCCCCTCCTGTTGAAAAAGAACCA
GTAGCATCGAGTACAGTATTGCAAAGTGAATCTAGAAatcaattaaaagt
taaaataaaaggtCCTTTCTTAAATGCTAAATACAACAACATTCAAAATC
AGCCAATATTACCAACAATTGATACATCAGctataagtatgaatatacCA
AGCCATTCAGTTCCTCCTTCAGAAGCTGCTAGTGTACCCTCCAATTTCAG
ACAAATGAGAAAAAAAGAATTACTGCGACAATATTGTAACCAACAAGATA
ATATCGAACAGACAACAAACCATCCCGTAGTCCCTCCATTAAGTCGAAAT
ATCATTACCATACCAAAAGCGGTAGCATCAATGACTACAATCCCTACTAA
AGAAGACTACAAAGCAGTGGTAGATGCTAATATGGAAAAGAAGCGTACTA
AATATGGATCTGATGATCcaaaatctaattatttcaacaatattcGTAAA
GAAGCWACAACacctaagataaaaataaaaattggtggCGAACAACCTAT
GGTCACAACAATGGAAGAAAAACGTAGTCTCCGTCCGCCCAAAAAAAGGA
TTTGTGATACTCAAAATGATGATACTAATCATTTGATAGCACCTACTATG
GAACAGTTAAGGCGAGACAGTATgaaattcagaaaaaaagtatttgctCG
TTTTGAAGAAGATGCATTAGCATCTACTTCAATTCCTATAGCTACtgttg
caaaaaataaaaagaaacgtCGGTCTAGTCCATCAGTATCTAGAAAAAAG
AAACCACGCACAAATAAAGAGATATCTCAGGTTCAAGTGATAGAAGCTAA
AGAAAGCACTCCAAAATTGATTATTAGATTCTCAAAAGCAGCACCTGATG
AAGCTGAAGTAAGTGCAGTAACAGAGCCAAAAAAAGCTTCTCCTATTAAA
CTGAAAATATCTAGATGCAAAGAAGGATATGTTATGAAACCTCCTAGTAA
YCAAACGAATCCTGATActtcattaaacaataattgtgaAGTTAGGTGAC
ggtaaaaattcttataaatttagATCAATCTTATCATTGATAAGCATTTY
gtgtaaaaaaattaataaaatgtaatttatttatttaattttagtttgta
cattcttatttatttatttaaaaaatttttaatttatttaaaatgtaaat
tcataatattaagacGTTGTTTTCCTCAATTTGTTGTTAATTGAActatt
aatacaaacaaatgtTCTATGAATACTccaagttattaatattatcatgt
taaggCCAGCAGatgtcaattaattttaattttgttatctaGTTTAAGAT
AAGAAATTTTCATGTTAATGTgcaatatgcaaaatattatgtaaagtatt
ttttttttttttttaagtattgttaacctttta
back to top

protein sequence of XM_015507633.1

>rna3663 ID=rna3663|Name=XM_015507633.1|organism=Diuraphis noxia|type=polypeptide|length=2377bp
MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKI
PSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEW
ERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKL
PKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGE
RTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICD
VCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPE
CVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIP
PSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDES
AEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAA
KLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLL
PKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRN
LLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDA
PDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSS
MSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTK
LSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKR
PTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTS
VSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHN
KHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLS
SVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDS
TTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEK
KNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVI
RAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSS
IGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDG
DQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRL
NDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQR
SIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTF
NNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTP
KILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSES
ALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEH
QNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFM
SSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMA
FTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTV
FNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHXLIPASTNNQTQ
EINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPK
NQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVS
QVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPS
DKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRG
RGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMR
ERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDP
PAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIV
NTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTV
LQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPP
SEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPK
AVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPK
IKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRD
SMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNK
EISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRC
KEGYVMKPPSNQTNPDTSLNNNCEVR.
back to top

mRNA from alignment at JOTR01000065:637477..652498+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3663 ID=rna3663|Name=XM_015507633.1|organism=Diuraphis noxia|type=mRNA|length=15022bp|location=Sequence derived from alignment at JOTR01000065:637477..652498+ (Diuraphis noxia)
tgtacctatatcgcCAATCGCTACTCGCAAGTGTCGAGCATGAAACGATA AGTGCGAAATTCGTACCGCTCGCATTTTGGTGTTTTCGTACACCGTTTTT ACCGCCGCTGTTTGGACGTTCGCCGTCGCGTATTCGTCGCCGTGACCGTT CGTCCGCTAGTGGATATCGCCGCCATCGTCCATTGAACCGCGCTCTCGCC CGACCTGTACCGCCGCCGATGTAAACGGGCCCCCCCGACCAAATGTGTTG GACGTGTTGAGAGCTGTTTGAGATTACCTAGTTGGTGTTACACTCATGTA AGTactcgtatattttttaaaacttctcTGGGCTTGCTTGATCGGTCTCT AACCCGGATGAGCCGTTGAGCCGATTGCAATTTTGGTTGTTAACGATTTT TTTCTCATGTCCTTTTTTTTCCTCTTCCCCGTCAAATCAAAACACGAAAA CACGGGAAAACGGCGGTGGTGCCATCTGCCGGCCGCCCGCATTTGTTGTC ATTATctacgttttattattacgcTCCtgagtgtaaaaatattaatttat gttatatttttattatattatagtatatattctTTCAGTGGGAAATCACA TACGGATTTTCCTAATTTTCTCCCCTCCCCCCCATTTAATAGTAGTCTAA TTTTACTTTCGTCACKTGCAACCAAATCCGTGATCTAACAAGCGCCCTAA CGTTTTTTCTTATGTCTCTTGTTTGTGTTCTTAGTGATTGTCAGTCGCCA GATGACGTCCCGTGTTTCAACTGCAATGGAATGCACTAGTATTGGTACAG TCCCAACCTGTTTGGCGCTTGAAAATTGATTTctgcaatacaatatatac ctggTAAGTTGTTGACGCTCATCACACACCATTCCTATTAGGTGTTGTAT AGATGTAAGTGTGTGCGTGTAATGCAACTAAGACCTCATAGTTCTTAGCA TCTTGAGCATCTTACATAGGTTCTATCTCTCAATTTCTATATGtactatc aatatttattttattttattctttcagTTCGTTCAATTGGCTAAATTATT AATGTCATACCTGCATGTATTGTTTAATTCATGCCGGGTCTCACTAAACA CTTGATAAATTAACAGTGAGCTAATTGTCCTTTAAACAACATTTAGTGgt ctattaaattttagtaatccattaatttcaatcaattttttatgcaacac gacatatatatgttaaaattgCGTCTGAGGAAGGTGCAGAACCGTTATAA CTTCAtcatataggtaacaataatatctGTTGGTTTTGCGTTAgagatta ttgtattatatttatttctttagaCTTAGTACTATAGAATACTTYttata ttataaattggtatatttttataattttatttgaagtgACTCTTAAGAAC AATGGccattgatataaaatatgcacataggtagttttatttatataaat atgaatcatATGATAATAGATTATTAGGAACATGgttcataaatacaaaa atatcaatttaagcAGTTTGTTAAGAAAATTGCGACAACTAAGaatttta ttgtgataaaaataatgttgaggTTCTAATTAACTTATGGGCAAAtcatt ggaaaataaaaataaaccaaatcaATTCACGTAACATTCACTTAACAAAA CTCTGACTGCCTTCCAGTTACACTCAGCAACAAAATCCTTCCTTCAGCAA ACAAAGTTAAGTACTTAGGGCTCACATTTGACAAACGTCTTACGTGGGKT CCACACCTAAAACTAAAGCGGAAACAAGTTAACTCCAGGCTGCACCTCCT TAGACCccttttaaaatctaaactatCCCTAACAAACAAGGTGACAATAT ATAAAGCGATAATCCGCCCTGTCTGGCTCTATGGCATTCAGCTATGGGGG TCTTCAAAGCCTTCCAATACCAGCTGAACTCTACAAGCTTTTCAATCAAT ATGCCTACGCCTAATAACCTCCGCCCCCTGGtacgtaacaaataaaaatc ttcACAAAGATTTAAATCTACCTACTCTTAACGATTTGGCCAAATCCCAT TATACCAAATTCTTTTCCAAACTCCACACTCATTACAACCCTTTAATCCA AAAATTATCCTCTGCCACACACGCTCCCAAAAGACTAATAAGGCTGTGGT CCCGAGACATGCTCAAagcataaacacaaaaaaaaaaaattaaaactata ccataattaacttaatgttaCTTGTCAGGTGGCACTACTGAGGGCCTTCC TTTTCTAATCTCCTTAATGTCGTAATAAAATTTTGTCATCATACTTActg attattgtaaaaatagattgtaaatatgttcttctaaataaattttaaaa aaaaaggttctaATCGAACAAATTCAATagtgataattaatatattttac actgaGATTCTCTAATGTTGCACTACAAATATTCAATTAGGTACCCATTA GTTTAAGTACTAAAAGtactacttatttattttggcattttatttgttca aaacaattttttatgttttgtaaattgAGTTAGCTGTTTTCATAAAAGTC TTATAATTAAACTCAATTGATTAAggataacttaaatttttattaaataa gattacctaaatattaatacaagaaGTTAAATCTTCtatgtttatcatta taataatttattaatgaaaatcctacttttataaatatttggttattatt ttataagctttctacctagtataatttaatataatattttctataaatat tcaaaacttgaaatatatattttttcaattataaataatctgcTGTTCTA AATTAGGCMttaaataaattataatttattaggtacctagtaggtattta atatttacaaaattggaacatttatattaagtaattactTCTTCTTGTTA GGCCCATTACCATTCCTGTGTGTAATTCCAATAGTTACATAAATGCAAAT TCAACAATTTGTAAAGTGTGAACCTACTTTTGTGATGTTGGTTCCAgtca ttaatatgtaaataactaCTACCTGATTTTAATGATCTTTTTTGACATAC TcattgaatcattttttatatttttggctTTATcgcataaatcaaaataa taaattaacccaagtaaattcaacatttttaaaagctcactaattaattt taataatcactaCTAACCTATTAATTGGCTTTGAATAGACAGAACTCACA TTTTGTGGAACTGAATAAAACTGCTATCCATCACCTAGTGACTTTCTATY cttaatattatataggtagttaaccACAAAAAAGCGAAACAATTTTCaag ttcttaaaaatgtataaacatgaTTTGGCCTttctaaaagaaatttaaag aCTATTCTTTGTAGTTKtaattataattttacaggtGGTAGCTACCTCTA GTGGAATTCAATCATTACAGACTTCAGCATTAGGGAAGTTTATTCAGTTT ATGCAAAACTAGTCTTTTTAATTCTGAATATACTATGATCACTATGCTTC CATTCTATTATAACTCAGTTTctcataatttgtaatttgtaaataaaaat aaaacatagccCATTCCTTTATTTTCTAAGGTCACTTACCAAATAGTCTT ACCCTTTGTATTGCCTTTGTATTgtatagtcattttttttagaattttta atcaaaaatatattgcagttttatcatttttatttggaCTTACAAAACGG AATATATTGTTAAGGTTCaacattttaaagattaatatttaaagaaataa ttccAGAGTAATTCAATCTTatccttattttaatttttgttttagtaacc tacctatatttatatttgcttACTAAACCATCATGCTGTGTGTTGAATGT ACCCTATTTATTTTCGGATCACTAGTCTGTATTGATACCTGGTTGTATCT AAATATTTGGCATTTTCTTTCTATATGAGCGAATTTATTTCCTCAATCCA gcttataatgatttatttatttttcagctaATTCTTCTAAAATAACATTC AGACATCTTTATTTCTACTCTGCTATGTGGTAAGTAGattcaattttttg ttgttttttttttaaacagattttttACCTCTCATTTTACTAATAGAGTG CCCATACCTATCTATAGGGTAGCTACAGTAATGACTTATCATAAATACAG CAGTGATGTattcctaaataatatattagaWCCATAAAGTTGTTGtgtga ttatttttaagaaaccaCTTAATTTATTCATCAGAAAATTATGTTAGAAT GAATTTTTGTCCTTTTGTGACTAGCTAAATACACACTTACAGGAACATTT CATTTTTGTACCTATGTTGGCAGGTACAGTGGCRTATCTAATAGAAAttc ttttttcttcaaatacCAATAgattttataccaatatttagataaataat gaaCTCAAGGCCTTAAGTTGCTTTCATTTAGTATTAtggaactaaattta aaaaaattacggaTAAGTATTATTTCATGGTACCTAATAGtttctaataa ttatgatttgaatTATAACTTAATTCCSGgcttaattctaatatttttat aaaaaacaataagtttTTTTRtgattaaatttaaaactgtttgCATTtgg ttaattttgatattagaatttgttattgtaaaaactattgcatttcttta tttaataatattatcMTTTACCGAAAGCtaactgtataattttaaataaa acctgGTTCTCATGATTTTCGTCTTAAATTACAAGATCATAAATATCCca agattaaataaaatctcgaataaaataaaaattaatgttgcagagcaaaa atagtataatagtgaaaaggttaataatgattttacgtacatacctactt taatttttGGAGGATGAATCCCCTTACAccctatataaacaatatacacc AATGATATAAggtctatattaaaaaatacatacctacatttattttacgc agatagaatatattatattatagttggttataattgaacttatttttgtg aaaaattattcatttcatagttaacaaaacatttttttatcaataaggTA CCTAGtaacttattacttttattaattttaatttaagtgttTATAGAAAC TAATGAATCAGACACTtttaaaagatacattttttatcctaaaaaaaaaa tgaaatagctatagttatttaatattgtattgtatagcttttttttatac aacaggCATCAATGCTGCAGAAGGCGGAGTTAGGTTTTTATCATTTGCAA ACTCAGCATGTCATATAGAACTAAACGTCAACCAATTTCTAAAGATGAAT GTCCATGTAAGTACTAAAAGTAACCAACTAAAATAAgtatatctaaattt attttatttttatagtaccgACAAAGAGGCGGAAGGGGCGCCCTTCGACG CTACAGGAAGAAGAAGAAGCGTCCTCTTTAGATACTCAAAGTGGCTCGCG TTCAGATATGAAAATACCAtcatcaatttataatacaagaaTAACAACTG ATGCACCAGCAGAAGtagatattttcttttatttacatattaYAAACTTT ATGTTAacgtttactttttttaaattttccattttaGTTATTTCGTAAAG ACTTGATCAGTGCCATGAAGCTTCCTGATTCTGAACAGTTATCTACTGAT GCATATTGGATTATTAGTGACCAATGGAAACAAGAATGGGAACGGGGTGT GCAAGTACCTGTTAATCCAGACTCTTTGCCTGGGTCAAGTGTTCATGAAA TTCCAGTTGTCTGCTTACAGTCTTCAACTAAATCACCTAGGCGTTCACCA TCATCAATTTATCACTCTCAACATAATGAATTTAAactgtatgtatttaa tatatttaatcttctctaataattataatttaatgatcttATTTTAGgcc aaaacataaatatattcgCATCACTAAAGACGAACATTTTAAATCCGAAG AACATCAACTGTCACTCTTACCTTTAAAAGCTGAAAAATCTTGTTCATAT GATATGGATGATGTAGATACAGCTTGGTTAAAACTGTGTAATGGTGAAAG AACATTAGGAGGTAATAAGTCAAAAgagttttaaacaaatacattaaaat attaaactaaatatttttttaggctTCCCAAAAATAAAAGATGATCAATT TGAGCGTGTTATGGAAGAATTAGAAATGAGGTGTTGGGAAAAAGTGCAAA CAATAATCAAGGAAGAAGAAGGCCTTGGAATCGAATACGATGAGAATGTA ATCTGCGATGTATGCCGTTCGGTTAGTTcgctgttaaataatattttata tctacttATTATAAAGGAACATtaagatacaaaatattatattacgtact aAGAAATCTTATACTTGCTTRTGTTCCCTCTGTCATGCCAATGTACAACA GCAAATTTATATTTAGCCAAACCAATTTTgtgttaatttgtatataaagt aaaaaaaaataaggtaatatagcgagtgattcttttatcattgaacactc attatttcaaaaattattgtttttgaaaatattattttacatagtttcaa gttgttaaaaaacctacgtttttattaaaaaaatattttttatccatata atttaataagttttttacttttttgaaccacaacatagatttttaatttc atattccaaagcagaatatttttctaagtattttgattcataaaaatYGA ATTTATAATGagtattttatgagttataagtatttaaagttcgacaagcg gagtagtggacaagcattttgcggggtaaccccgtaccactccactctgc caatcagaactttaaatacttataactcatcaactactcgtcctaaattc gatttttatgaatcaaaatattctgctttggactatgaaattaaaactat gttgtcatacaaaaaagtaatgaacttaaaaaatattttaaaataaaatt ttttaataaaaacgttggtttttgaaYAACttgaaactattaaaaaaata ttttcaaaaacattagtaatttttgaaataatgaatgttcaatgataaaa taatcaccagGTATAGGTAAACATMTTATCTCCATTATGATTGCAACACA CTGTAGGGTTGCTGGTAAAATTCTATTGTCTTGACGAGGGCAGTAATTGT GTCCGGCTGCAAGTAGGaacaattactattaaatattaaaatattgtaaa aatttagtttataaataggtaatattcttacctttaaatttgataaaagg tCAAAATTGGTTCTACTgcacacaaattatttatgatgtacATTGTAAGA TAGAGCAACACATGCATTTATGGCTGTGTTTTTGTCACTGACCAGATTAA GTAACAATTATTTGAATCGgcttagcatttttttttaaaaataatttggt tttaaCATTATTCTAATATCTCTAATGTTCCTAAAGAAACCTAGTAACAT AAAGatgacttatttaattttttcatttctgCAGTAACTTATAACTAGTT AACAGAATTCCATCATTTAAAGTATTTGAGCACTTACAGTAGTTTTAAGA CAGTTTACATGGAGCTTTTGTTTGGATTTtccttgttttatttattaaaa tgtgtatgcaAAGTCTGTATCAGATGAACCAGACAAATGAAGTAACTCaa gttaaaatcaatatttttttattatatttaaaaatactcctGTATTTcgt gcattataaaatatatatttttgttaattataaaatagacaatttttaga tcgattttttttaaaaatgattgatgGTAAAAAACGTTTATCCATGTTAa gtgtttcattttttataataaccatacttaaataataattgagaaaatta AGTACAGTTcttaaaatatctcaaaaacaTAAGATACTCTATAAACTATT ACAATAGTTATTGAGgctggaaataatttaatatttataaatatataata acaatttttatcattttagccTGATTCAGAAGATGGTAATGAAATGGTGT TTTGTGATAATTGCAATATTTGTGTTCATCAAGCGTGTTATGGTATTACC ACAATCCCATCTGGGTCTTGGCTATGTCGTACTTGTACTTTACGTTTTCG TCCTGAATGTGTACTTTGTCCAAATAAAAATGGTGCAATGAAATGCACAC GGTCAGGTCATAAATGGGCRCATGTGTCATGTGCATTGTGGATACCAGAA GTTAGCATTGGATGTGTAGAAAAAATGGAACCTATTACCAAAATATCAAG TATACCTGTAAGTATCATCAGAAACATGGTACTATAAAtcaagaattaaa taataataatatattacattattttagccTAGTCGATGGGCTcttatatg tgtattgtgtcgAGAACGAGTCGGAGCATGTATACAGTGTTCAGTTAAAA CATGCAAGACTGCATATCATGTTACTTGTGCTTTTAAGCACGGTCTTGAA ATGAGAGCTATTATTGAAGATGAGAGTGCTGAAGATGGAGTTAAATTACG GGTTAGTATCATTAGACATACATttcatgcatttaaaattttatgataca gtattattgaaacaatttactaaatattCTAGTCATACTGTCAAAAACAT AGTGTAACTAGTAAAAAAGATAGAAATTCTGGTTCAGAAGATGAAGATTC TACAAAAAGGAAACGAAAAGATATGACTtctgaagaaaaaaatcaaGCTA GAGCGGCCAAGTAAgcatatatcaaaaaaattaaaatgaataatacattt tataaaaatgatttttttgcaGGCTGCAAGAAATTGAAGGCGAATTTGAA AAGCATGTCAGTGTCATTGATGTTACACAATGTCGTGATGTTGATAATGA TggtattctatatatttataattattgggtATTAAAAAGAAGATCTGGAA ATAACAGACCTTTGTTATTACCAAAATCTGATGATGGTGATCTTCTTGGA AGACAACAAGAACAAGCagatttagaaaaacataaaatgtttgtacaact TAGACAAGATTTAGAAAGGGTAAGTTATTAAActgacttaaatattatta ctttagtacatgttacaataattgaagttaattattaaattaaatttggt tgTTAGGTACGGAATTTGTGCTACATGGTCAGCAGAAGAGAAAAGCTTTC TCGTAATTTACTCAGCTTACGTGAGCAAACTTTTCATAAACAAGTTGCAG TTCTTACAGATAACAAGCTTAATCTTAGTTCAGCAGAAGTTTCAGCCRTC CAGGAAGCTAATCATGGGCCATCAATATATGATCGATTGTATTCGTATCC TGATGCTCCAGACTTGAGCACTGATTTTGAAACTATGTTATCTCGTATTG CTGGAGATGGTTCTCCAGAAAAATCCAATTATACTGGTTTAAAGTGGCCT CAAAGTAATAATCCATATAAACGGTCATATATTAATGGATCTATACGATA CTCGAGTATGTCAAGCAGTAGTGATCTTGAACTAAAACCTCCTAGACTAA TTAGTAGTGAACGATCAAGTATGGATGAAGctgaattaattaaatctatg tTGAATAAAcgtaaattaaaagaaaaaaggcTTAATAAAAAACgttcaaa aacaaaactttCTACTGATTCATCTACTGAAGAAGAAAATGATAAAGTTA AACAAAAATGGAATGTATCRcctaataaaaaattgttacaaattGAAAAG CAATTTGGTAGTGATGATAGTGAAGATGTTTCCTTACCAAAACTTTCATC TAAACGTCCAactaaagttaataatatctattctgACTCAGATTCTGAAG TGTCAACCAAAGATGATAGTCTCTCGTACACACACACTAAAGCAGCAGTT AAAGAGTTCTCTCAAGGAAAGTCTAAAACTAAAGTTCTTAAAGATAAAAG TACTTCTGTTTCTAAAACTAAAGAATCACTAGAGAaggatactaaaaaaa ttaaaaaagatgatcctaaaaataatactacagTGCCTACAGAACTTATT GTTCCTCAAAGACAAGCTGCTAAGAAAGCTACTGAAAGTATTCATCGGGT ACATAATAAACATGATGAAATTTCAAATGAAAAGAAATCTCCAGAAAAAC TATTTTCATCACATAGAAAATCTCCTGAAAGGGTTTCATCTAATACTAAA TCACCAGATAAACAACctattaaagttaataaaattaaaaacgctgAAAA ATTAAGTTCAGTAGAAAAAGAATCTGATCTACAAGATTCATTTAGTATTG TTCCACAGAGGCAGGCTGCTAAAAAAGCCATTCAAGGCATTAAGAGTGGT ATGACAAAACCTGTTGAAGAAACTAAAGTATCTGAACCTGTTAAAAAAGA CGATTCAACTACCAAGTCGAAACGTAGTGCAAAGTCTTCTTTATCCTCTA CATCGAGTAGTAGTTCTTCTAGTAGTTCATCAAGTACTTCAAGTACTTCT AGTTCTTCTTCTTCATCAGGTTCGTCTACTTCTGAAAGTGATACAGAACC AGAAAAGAAGAATAAATCTATTGATCGTGTAAGTCCACCAAAAGAAATTA GTAAAACTAAAAGCCCTCCTAAAGCTAAAGGTTGGTTATCAGAGAATAAG CCTATTAAAATTAGTTCCTCCTCTAGTAGTGAGTCTGATAAAGACCAGAA AGTGATCAGGGCGCCAGACAAGAAGCTTAAAACTTCCGACAGGCGGCCTG AACACAGGTTTCAGGATCCGCCACCTAAGAGAGAGGAATCTAGAAGAAAA TCGATTGGAAGTGATCGATGCGATTCTGTTCAAATCGTCACATGTGGAGA TTCTAGTATCGGGGATGATGGAAATAGAAAATCGAGCGATAGTGACAACG TTGGAACATCAACTAGTCAGCCGGACGGAATTAAACAAGAAACGAAACAG CCCATACATGCAGTTGAGGACAAAGAGGTTGAGAAGAAGTTGAAACTTGA TGATGGTGATCAGAGAGTTCTCAAAGAAGACCATGGccttaacaaaaata ttcaagaagtgaaaaataaaaatgtaactccCGTACAACATACATCTGat aaagaaaataagaaaaccgATGAATTAAACTTGTATTTACCAGGTGGTCA TCGTTTAAATGATCTCAAAGACGAAAATTTATTAAGCTCTTCATTTCTAA CCAGACAAGACATAGAACGagaattagttaataatattgattatgataat aagAAATACTCTAAAATGYCGTTCAACtgtaataatcatttttctGGAAG TCAAAGATCAATTTTTTCTCCACAACAATGTAATAAAGATATTCCAGATT TTGACTTTGATAATGATATGTTAGCTGTTGAACAAGCTGCAAATGAAGAA GGATTTGGGTTAACAAGAGACACAGATGTTCGAAATGCTCCATTATCTTT TACATTCAACAATGAGTTCCTCTTCAAAGATGATTCAAAAGAAATTACAG CTAGAGAAACATTAAACCTTGTTGAAAAGTTGAGATTAGGAATCACCAAA AAAACTGTACCGTTAGAAAATGAGaacatagaaaatattgaattaaacga TACTCCTAAAATACTTGATCCACCTAAACCATCTGAACCAGAACAAAAGA CAGACAATATTCTGTATAATGCATACAACAAATTCCATCAACAGTCCAAT GATGTAGTAGATGTGAATAAAGTTCCAGAACGAGATAAATTGGATAGGAG TGAAAGTGCTTTATCTGACGAGAGGTGGGTACCACCTAGTCAACGTAGTC AGGCAGAATCTCCTTATCAGGATATTAATGATGCCAACCGTTGGTCAGAT AGCGTTGTGATGCCATCTAGACGTTCAGATACCTCCAATGAACCATCTCC AGAACATCAAAATCCACCTACAACAGAgtcattatatcaaaatatacact CGTTTCCTACATCTGTTCCAATGCAAATAGAAAGTATGCAGTTTCCTCAG TTTTCAGAACCATCATTTGTATTGAACCCACCTTCTAGTAATCAGTTGTC TTTTATGTCTTCTTCGCGGAATTTTAATCCTCAACAATTTGCAATACCTC CACCATTCTCAGCTCATCAAAATTTGATGCCAGAGTTGAATAAACCATTA CATTTGCAGCAAACTCCTTGTACAGCAGCCTTCACTTCATCAACTCAAAA TATGGCATTTACTGCAGCCATGATATCTCCAATGACACATCACGATAATT TTATTCCACCGTTTAAtgatataagtatgtataatgATAGCAATCTTTTA ATGGGTCCTAGTACTAATAATTCATCTTTACATTCAGAATCTGTCATGCA TACTGTATTCAATGCAATTAATCAAGCATCTATGATTGATAATCAACTAT CTATTTTACCAACAATTCAAACTCCTAAAACTCCTAAAGTCTCTACCAGT AATCAAATTTCTGGTAGTCATRATCTAATCCCAGCTTCAACAAATAACCA AACCcaagaaattaatttacaatcaaCCTCAAATCAACACCAAGTACCAG TAACTTCTAATAATCAAACTGAAATAACTCTTTCACAATCAATTTCAAAC AATCAAGAACCTGTTTTTAgtcaaagtaaaattaatagtgAACAAGTAAC GCCCAAGAATCAATTAGCAGCACCAATATCAAACCAAATACCATTGAATA AACAACAATCGATTCCAGAAGTACATACACCGTTAGTATGTCAAGCAGAA GTTAGTCAACAAAACATCATTAATCAAACACCAGTGCAGACCCCTATCAG TGTCAGTCAAGTATCTAATCAAACTACTCCAAGTATACCAACTCCTAAAC AATCACCTGCTCTTCCTACAACTCCTTTGCCAGAACGATCACCAATGTCA ATTATTGCTTCATCTCCTTCTGTGACTAGTTCACCACATCCTAATCGCAC ACCTTCTGATAAAAAATCTCCTTCTAAACCTACTCGATCTTCAAGTCGTG TTACTGCTCAATCTTATAAATCACCTGAAATAGTTGATCATTCACCAGAA GTTAAAAAACAGAATAAACGAGGACCAAAACCTCAATCCAAAACTTCTGG ACGTGGTCGAGGTCGTGGGCGTGGGCGTTCATCGAATCATTTTACTGATT ATAATCCTGCTGTTAGTAAGCTTGCTGGTACTGCTTATGATCTTGATTTT GTCGAAGAATttggtaatgataataatggtgTTATGGAGAATCTTCGAGC AATGCGTGAACGTAAAAAGTCTGATGTTAAAGCTGATAGTAAATCACCTG TATCTCCTAAAGTACATAGCAGCCCTAATAACTATAGAAGAAAACATGCT AGTATAAAAGAACTTAAACCTCCTTCCCCCATCACGGAAACTCCTATTGA AGATCCACCAGCTCAAATAATAATGGATGAACTGACTCCTATGTTACCTG CGCCCGTTGATATGAGAACATATGATTCATACGATAATACAACATCATAT TCTGATAACATTTATGAAACCAACACTAATGTTGATGATAAAGTAACTGA TATTGTGAATACCTTAAAAGAAGActtacataatttttcaaaattatctt CCAAAGATAAAGATATTGAAGAtcagttaattttaattgatgacCAGATC AAGATAATTAAATTACCCCCTCCTGTTGAAAAAGAACCAGTAGCATCGAG TACAGTATTGCAAAGTGAATCTAGAAatcaattaaaagttaaaataaaag gtCCTTTCTTAAATGCTAAATACAACAACATTCAAAATCAGCCAATATTA CCAACAATTGATACATCAGctataagtatgaatatacCAAGCCATTCAGT TCCTCCTTCAGAAGCTGCTAGTGTACCCTCCAATTTCAGACAAATGAGAA AAAAAGAATTACTGCGACAATATTGTAACCAACAAGATAATATCGAACAG ACAACAAACCATCCCGTAGTCCCTCCATTAAGTCGAAATATCATTACCAT ACCAAAAGCGGTAGCATCAATGACTACAATCCCTACTAAAGAAGACTACA AAGCAGTGGTAGATGCTAATATGGAAAAGAAGCGTACTAAATATGGATCT GATGATCcaaaatctaattatttcaacaatattcGTAAAGAAGCWACAAC acctaagataaaaataaaaattggtggCGAACAACCTATGGTCACAACAA TGGAAGAAAAACGTAGTCTCCGTCCGCCCAAAAAAAGGATTTGTGATACT CAAAATGATGATACTAATCATTTGATAGCACCTACTATGGAACAGTTAAG GCGAGACAGTATgaaattcagaaaaaaagtatttgctCGTTTTGAAGAAG ATGCATTAGCATCTACTTCAATTCCTATAGCTACtgttgcaaaaaataaa aagaaacgtCGGTCTAGTCCATCAGTATCTAGAAAAAAGAAACCACGCAC AAATAAAGAGATATCTCAGGTTCAAGTGATAGAAGCTAAAGAAAGCACTC CAAAATTGATTATTAGATTCTCAAAAGCAGCACCTGATGAAGCTGAAGTA AGTGCAGTAACAGAGCCAAAAAAAGCTTCTCCTATTAAACTGAAAATATC TAGATGCAAAGAAGGATATGTTATGAAACCTCCTAGTAAYCAAACGAATC CTGATActtcattaaacaataattgtgaAGTTAGGTGACggtaaaaattc ttataaatttagATCAATCTTATCATTGATAAGCATTTYgtgtaaaaaaa ttaataaaatgtaatttatttatttaattttagtttgtacattcttattt atttatttaaaaaatttttaatttatttaaaatgtaaattcataatatta agacGTTGTTTTCCTCAATTTGTTGTTAATTGAActattaatacaaacaa atgtTCTATGAATACTccaagttattaatattatcatgttaaggCCAGCA GatgtcaattaattttaattttgttatctaGTTTAAGATAAGAAATTTTC ATGTTAATGTgcaatatgcaaaatattatgtaaagtattttttttttttt tttaagtattgttaacctttta
back to top

Coding sequence (CDS) from alignment at JOTR01000065:637477..652498+

>rna3663 ID=rna3663|Name=XM_015507633.1|organism=Diuraphis noxia|type=CDS|length=7131bp|location=Sequence derived from alignment at JOTR01000065:637477..652498+ (Diuraphis noxia)
ATGTCATATAGAACTAAACGTCAACCAATTTCTAAAGATGAATGTCCATt
accgACAAAGAGGCGGAAGGGGCGCCCTTCGACGCTACAGGAAGAAGAAG
AAGCGTCCTCTTTAGATACTCAAAGTGGCTCGCGTTCAGATATGAAAATA
CCAtcatcaatttataatacaagaaTAACAACTGATGCACCAGCAGAATT
ATTTCGTAAAGACTTGATCAGTGCCATGAAGCTTCCTGATTCTGAACAGT
TATCTACTGATGCATATTGGATTATTAGTGACCAATGGAAACAAGAATGG
GAACGGGGTGTGCAAGTACCTGTTAATCCAGACTCTTTGCCTGGGTCAAG
TGTTCATGAAATTCCAGTTGTCTGCTTACAGTCTTCAACTAAATCACCTA
GGCGTTCACCATCATCAATTTATCACTCTCAACATAATGAATTTAAactg
ccaaaacataaatatattcgCATCACTAAAGACGAACATTTTAAATCCGA
AGAACATCAACTGTCACTCTTACCTTTAAAAGCTGAAAAATCTTGTTCAT
ATGATATGGATGATGTAGATACAGCTTGGTTAAAACTGTGTAATGGTGAA
AGAACATTAGGAGgctTCCCAAAAATAAAAGATGATCAATTTGAGCGTGT
TATGGAAGAATTAGAAATGAGGTGTTGGGAAAAAGTGCAAACAATAATCA
AGGAAGAAGAAGGCCTTGGAATCGAATACGATGAGAATGTAATCTGCGAT
GTATGCCGTTCGccTGATTCAGAAGATGGTAATGAAATGGTGTTTTGTGA
TAATTGCAATATTTGTGTTCATCAAGCGTGTTATGGTATTACCACAATCC
CATCTGGGTCTTGGCTATGTCGTACTTGTACTTTACGTTTTCGTCCTGAA
TGTGTACTTTGTCCAAATAAAAATGGTGCAATGAAATGCACACGGTCAGG
TCATAAATGGGCRCATGTGTCATGTGCATTGTGGATACCAGAAGTTAGCA
TTGGATGTGTAGAAAAAATGGAACCTATTACCAAAATATCAAGTATACCT
ccTAGTCGATGGGCTcttatatgtgtattgtgtcgAGAACGAGTCGGAGC
ATGTATACAGTGTTCAGTTAAAACATGCAAGACTGCATATCATGTTACTT
GTGCTTTTAAGCACGGTCTTGAAATGAGAGCTATTATTGAAGATGAGAGT
GCTGAAGATGGAGTTAAATTACGGTCATACTGTCAAAAACATAGTGTAAC
TAGTAAAAAAGATAGAAATTCTGGTTCAGAAGATGAAGATTCTACAAAAA
GGAAACGAAAAGATATGACTtctgaagaaaaaaatcaaGCTAGAGCGGCC
AAGCTGCAAGAAATTGAAGGCGAATTTGAAAAGCATGTCAGTGTCATTGA
TGTTACACAATGTCGTGATGTTGATAATGATggtattctatatatttata
attattgggtATTAAAAAGAAGATCTGGAAATAACAGACCTTTGTTATTA
CCAAAATCTGATGATGGTGATCTTCTTGGAAGACAACAAGAACAAGCaga
tttagaaaaacataaaatgtttgtacaactTAGACAAGATTTAGAAAGGG
TACGGAATTTGTGCTACATGGTCAGCAGAAGAGAAAAGCTTTCTCGTAAT
TTACTCAGCTTACGTGAGCAAACTTTTCATAAACAAGTTGCAGTTCTTAC
AGATAACAAGCTTAATCTTAGTTCAGCAGAAGTTTCAGCCRTCCAGGAAG
CTAATCATGGGCCATCAATATATGATCGATTGTATTCGTATCCTGATGCT
CCAGACTTGAGCACTGATTTTGAAACTATGTTATCTCGTATTGCTGGAGA
TGGTTCTCCAGAAAAATCCAATTATACTGGTTTAAAGTGGCCTCAAAGTA
ATAATCCATATAAACGGTCATATATTAATGGATCTATACGATACTCGAGT
ATGTCAAGCAGTAGTGATCTTGAACTAAAACCTCCTAGACTAATTAGTAG
TGAACGATCAAGTATGGATGAAGctgaattaattaaatctatgtTGAATA
AAcgtaaattaaaagaaaaaaggcTTAATAAAAAACgttcaaaaacaaaa
ctttCTACTGATTCATCTACTGAAGAAGAAAATGATAAAGTTAAACAAAA
ATGGAATGTATCRcctaataaaaaattgttacaaattGAAAAGCAATTTG
GTAGTGATGATAGTGAAGATGTTTCCTTACCAAAACTTTCATCTAAACGT
CCAactaaagttaataatatctattctgACTCAGATTCTGAAGTGTCAAC
CAAAGATGATAGTCTCTCGTACACACACACTAAAGCAGCAGTTAAAGAGT
TCTCTCAAGGAAAGTCTAAAACTAAAGTTCTTAAAGATAAAAGTACTTCT
GTTTCTAAAACTAAAGAATCACTAGAGAaggatactaaaaaaattaaaaa
agatgatcctaaaaataatactacagTGCCTACAGAACTTATTGTTCCTC
AAAGACAAGCTGCTAAGAAAGCTACTGAAAGTATTCATCGGGTACATAAT
AAACATGATGAAATTTCAAATGAAAAGAAATCTCCAGAAAAACTATTTTC
ATCACATAGAAAATCTCCTGAAAGGGTTTCATCTAATACTAAATCACCAG
ATAAACAACctattaaagttaataaaattaaaaacgctgAAAAATTAAGT
TCAGTAGAAAAAGAATCTGATCTACAAGATTCATTTAGTATTGTTCCACA
GAGGCAGGCTGCTAAAAAAGCCATTCAAGGCATTAAGAGTGGTATGACAA
AACCTGTTGAAGAAACTAAAGTATCTGAACCTGTTAAAAAAGACGATTCA
ACTACCAAGTCGAAACGTAGTGCAAAGTCTTCTTTATCCTCTACATCGAG
TAGTAGTTCTTCTAGTAGTTCATCAAGTACTTCAAGTACTTCTAGTTCTT
CTTCTTCATCAGGTTCGTCTACTTCTGAAAGTGATACAGAACCAGAAAAG
AAGAATAAATCTATTGATCGTGTAAGTCCACCAAAAGAAATTAGTAAAAC
TAAAAGCCCTCCTAAAGCTAAAGGTTGGTTATCAGAGAATAAGCCTATTA
AAATTAGTTCCTCCTCTAGTAGTGAGTCTGATAAAGACCAGAAAGTGATC
AGGGCGCCAGACAAGAAGCTTAAAACTTCCGACAGGCGGCCTGAACACAG
GTTTCAGGATCCGCCACCTAAGAGAGAGGAATCTAGAAGAAAATCGATTG
GAAGTGATCGATGCGATTCTGTTCAAATCGTCACATGTGGAGATTCTAGT
ATCGGGGATGATGGAAATAGAAAATCGAGCGATAGTGACAACGTTGGAAC
ATCAACTAGTCAGCCGGACGGAATTAAACAAGAAACGAAACAGCCCATAC
ATGCAGTTGAGGACAAAGAGGTTGAGAAGAAGTTGAAACTTGATGATGGT
GATCAGAGAGTTCTCAAAGAAGACCATGGccttaacaaaaatattcaaga
agtgaaaaataaaaatgtaactccCGTACAACATACATCTGataaagaaa
ataagaaaaccgATGAATTAAACTTGTATTTACCAGGTGGTCATCGTTTA
AATGATCTCAAAGACGAAAATTTATTAAGCTCTTCATTTCTAACCAGACA
AGACATAGAACGagaattagttaataatattgattatgataataagAAAT
ACTCTAAAATGYCGTTCAACtgtaataatcatttttctGGAAGTCAAAGA
TCAATTTTTTCTCCACAACAATGTAATAAAGATATTCCAGATTTTGACTT
TGATAATGATATGTTAGCTGTTGAACAAGCTGCAAATGAAGAAGGATTTG
GGTTAACAAGAGACACAGATGTTCGAAATGCTCCATTATCTTTTACATTC
AACAATGAGTTCCTCTTCAAAGATGATTCAAAAGAAATTACAGCTAGAGA
AACATTAAACCTTGTTGAAAAGTTGAGATTAGGAATCACCAAAAAAACTG
TACCGTTAGAAAATGAGaacatagaaaatattgaattaaacgaTACTCCT
AAAATACTTGATCCACCTAAACCATCTGAACCAGAACAAAAGACAGACAA
TATTCTGTATAATGCATACAACAAATTCCATCAACAGTCCAATGATGTAG
TAGATGTGAATAAAGTTCCAGAACGAGATAAATTGGATAGGAGTGAAAGT
GCTTTATCTGACGAGAGGTGGGTACCACCTAGTCAACGTAGTCAGGCAGA
ATCTCCTTATCAGGATATTAATGATGCCAACCGTTGGTCAGATAGCGTTG
TGATGCCATCTAGACGTTCAGATACCTCCAATGAACCATCTCCAGAACAT
CAAAATCCACCTACAACAGAgtcattatatcaaaatatacactCGTTTCC
TACATCTGTTCCAATGCAAATAGAAAGTATGCAGTTTCCTCAGTTTTCAG
AACCATCATTTGTATTGAACCCACCTTCTAGTAATCAGTTGTCTTTTATG
TCTTCTTCGCGGAATTTTAATCCTCAACAATTTGCAATACCTCCACCATT
CTCAGCTCATCAAAATTTGATGCCAGAGTTGAATAAACCATTACATTTGC
AGCAAACTCCTTGTACAGCAGCCTTCACTTCATCAACTCAAAATATGGCA
TTTACTGCAGCCATGATATCTCCAATGACACATCACGATAATTTTATTCC
ACCGTTTAAtgatataagtatgtataatgATAGCAATCTTTTAATGGGTC
CTAGTACTAATAATTCATCTTTACATTCAGAATCTGTCATGCATACTGTA
TTCAATGCAATTAATCAAGCATCTATGATTGATAATCAACTATCTATTTT
ACCAACAATTCAAACTCCTAAAACTCCTAAAGTCTCTACCAGTAATCAAA
TTTCTGGTAGTCATRATCTAATCCCAGCTTCAACAAATAACCAAACCcaa
gaaattaatttacaatcaaCCTCAAATCAACACCAAGTACCAGTAACTTC
TAATAATCAAACTGAAATAACTCTTTCACAATCAATTTCAAACAATCAAG
AACCTGTTTTTAgtcaaagtaaaattaatagtgAACAAGTAACGCCCAAG
AATCAATTAGCAGCACCAATATCAAACCAAATACCATTGAATAAACAACA
ATCGATTCCAGAAGTACATACACCGTTAGTATGTCAAGCAGAAGTTAGTC
AACAAAACATCATTAATCAAACACCAGTGCAGACCCCTATCAGTGTCAGT
CAAGTATCTAATCAAACTACTCCAAGTATACCAACTCCTAAACAATCACC
TGCTCTTCCTACAACTCCTTTGCCAGAACGATCACCAATGTCAATTATTG
CTTCATCTCCTTCTGTGACTAGTTCACCACATCCTAATCGCACACCTTCT
GATAAAAAATCTCCTTCTAAACCTACTCGATCTTCAAGTCGTGTTACTGC
TCAATCTTATAAATCACCTGAAATAGTTGATCATTCACCAGAAGTTAAAA
AACAGAATAAACGAGGACCAAAACCTCAATCCAAAACTTCTGGACGTGGT
CGAGGTCGTGGGCGTGGGCGTTCATCGAATCATTTTACTGATTATAATCC
TGCTGTTAGTAAGCTTGCTGGTACTGCTTATGATCTTGATTTTGTCGAAG
AATttggtaatgataataatggtgTTATGGAGAATCTTCGAGCAATGCGT
GAACGTAAAAAGTCTGATGTTAAAGCTGATAGTAAATCACCTGTATCTCC
TAAAGTACATAGCAGCCCTAATAACTATAGAAGAAAACATGCTAGTATAA
AAGAACTTAAACCTCCTTCCCCCATCACGGAAACTCCTATTGAAGATCCA
CCAGCTCAAATAATAATGGATGAACTGACTCCTATGTTACCTGCGCCCGT
TGATATGAGAACATATGATTCATACGATAATACAACATCATATTCTGATA
ACATTTATGAAACCAACACTAATGTTGATGATAAAGTAACTGATATTGTG
AATACCTTAAAAGAAGActtacataatttttcaaaattatcttCCAAAGA
TAAAGATATTGAAGAtcagttaattttaattgatgacCAGATCAAGATAA
TTAAATTACCCCCTCCTGTTGAAAAAGAACCAGTAGCATCGAGTACAGTA
TTGCAAAGTGAATCTAGAAatcaattaaaagttaaaataaaaggtCCTTT
CTTAAATGCTAAATACAACAACATTCAAAATCAGCCAATATTACCAACAA
TTGATACATCAGctataagtatgaatatacCAAGCCATTCAGTTCCTCCT
TCAGAAGCTGCTAGTGTACCCTCCAATTTCAGACAAATGAGAAAAAAAGA
ATTACTGCGACAATATTGTAACCAACAAGATAATATCGAACAGACAACAA
ACCATCCCGTAGTCCCTCCATTAAGTCGAAATATCATTACCATACCAAAA
GCGGTAGCATCAATGACTACAATCCCTACTAAAGAAGACTACAAAGCAGT
GGTAGATGCTAATATGGAAAAGAAGCGTACTAAATATGGATCTGATGATC
caaaatctaattatttcaacaatattcGTAAAGAAGCWACAACacctaag
ataaaaataaaaattggtggCGAACAACCTATGGTCACAACAATGGAAGA
AAAACGTAGTCTCCGTCCGCCCAAAAAAAGGATTTGTGATACTCAAAATG
ATGATACTAATCATTTGATAGCACCTACTATGGAACAGTTAAGGCGAGAC
AGTATgaaattcagaaaaaaagtatttgctCGTTTTGAAGAAGATGCATT
AGCATCTACTTCAATTCCTATAGCTACtgttgcaaaaaataaaaagaaac
gtCGGTCTAGTCCATCAGTATCTAGAAAAAAGAAACCACGCACAAATAAA
GAGATATCTCAGGTTCAAGTGATAGAAGCTAAAGAAAGCACTCCAAAATT
GATTATTAGATTCTCAAAAGCAGCACCTGATGAAGCTGAAGTAAGTGCAG
TAACAGAGCCAAAAAAAGCTTCTCCTATTAAACTGAAAATATCTAGATGC
AAAGAAGGATATGTTATGAAACCTCCTAGTAAYCAAACGAATCCTGATAc
ttcattaaacaataattgtgaAGTTAGGTGA
back to top