rna3668 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507627.1
Unique Namerna3668
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:692291..707460 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507627.1
Productendoribonuclease Dcr-1, transcript variant X1
Model evidenceSupporting evidence includes similarity to: 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161280
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507627.1
GeneID107161280
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161280gene2480Diuraphis noxiageneJOTR01000065 692291..707460 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507627.1rna3668Diuraphis noxiapolypeptideJOTR01000065 693643..707340 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32053id32053Diuraphis noxiaexonJOTR01000065 692291..692715 +
id32054id32054Diuraphis noxiaexonJOTR01000065 693604..693818 +
id32055id32055Diuraphis noxiaexonJOTR01000065 693886..694027 +
id32056id32056Diuraphis noxiaexonJOTR01000065 694100..694228 +
id32057id32057Diuraphis noxiaexonJOTR01000065 695431..696303 +
id32058id32058Diuraphis noxiaexonJOTR01000065 696380..696513 +
id32059id32059Diuraphis noxiaexonJOTR01000065 696605..696836 +
id32060id32060Diuraphis noxiaexonJOTR01000065 696917..697068 +
id32061id32061Diuraphis noxiaexonJOTR01000065 697225..697366 +
id32062id32062Diuraphis noxiaexonJOTR01000065 699986..700222 +
id32063id32063Diuraphis noxiaexonJOTR01000065 700301..700480 +
id32064id32064Diuraphis noxiaexonJOTR01000065 701508..701721 +
id32065id32065Diuraphis noxiaexonJOTR01000065 701783..701955 +
id32066id32066Diuraphis noxiaexonJOTR01000065 702011..702195 +
id32067id32067Diuraphis noxiaexonJOTR01000065 702251..702504 +
id32068id32068Diuraphis noxiaexonJOTR01000065 702564..703925 +
id32069id32069Diuraphis noxiaexonJOTR01000065 703992..704309 +
id32070id32070Diuraphis noxiaexonJOTR01000065 704369..704589 +
id32071id32071Diuraphis noxiaexonJOTR01000065 704945..705110 +
id32072id32072Diuraphis noxiaexonJOTR01000065 706358..706433 +
id32073id32073Diuraphis noxiaexonJOTR01000065 707184..707460 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363113.1cds3572Diuraphis noxiaCDSJOTR01000065 707184..707340 +


Sequences
The following sequences are available for this feature:

protein sequence of XM_015507627.1

>rna3668 ID=rna3668|Name=XM_015507627.1|organism=Diuraphis noxia|type=polypeptide|length=1841bp
MALTFGDNIHTRTFTPQEYLVEILSSAKNKNIIISLEGTTNKVFVILKLI
RELAFKIYRKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHL
DFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKI
CNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDI
VSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAII
YGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYM
VEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSP
RVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLA
RRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDF
GWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVL
EAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNI
LSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSP
FVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLP
INSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESF
HALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPV
EGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSI
PPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKC
HVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNE
DRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIE
NYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILP
TSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINA
LLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEI
STIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNN
IDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFR
NTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQ
IIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVL
SDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNH
PGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVH
EGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPH
KLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKEN
TPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIK
VLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQ
DRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHS
PGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEE
NGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDT
VWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRV
RVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK.
back to top

mRNA from alignment at JOTR01000065:692291..707460+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3668 ID=rna3668|Name=XM_015507627.1|organism=Diuraphis noxia|type=mRNA|length=15170bp|location=Sequence derived from alignment at JOTR01000065:692291..707460+ (Diuraphis noxia)
CAGACAATAGACATTAAACAaactaaacattaaacaaaaacaaaaacaaa gtgAAAAACATGTCTAAAGTTGCAGATTTCCTGTTATTTGTTATTCTTAT TCCTTAAATAACCAGTAATCCTGACTCCtttcatattatacttgtttata ACTCCTTTGAAGTCGTACACTACAACAAAAAGTGCGTTTAGCCGTCTTCC ATCGGTCCATAGTTCAGACGTCCACCAGTCTACATAAATTCCAATGTATT TAGTTTCAAGAATCTAATgatcttttaaataataacaatcatataactat ttttaataatatgaagcattactaatattatcttaatttagtttcaataa tgaagttaataatattttagaaattgaatttatttttattggagaGAGAC TTTATTCATCAGtgacaatatttatgtatgtataattttttgttatttga ataaaagaaaaagataatattttttttaaggtccACCTACCtacttgaat aattaaataattattttgataaaaaataatttttgtttgtttttatatat acatatatgtaaatgTACATACTTTTAGTACCTATGACCAGTGGTAACAA ATTCATAAATCATGTGAAGCGATTGCTTGACTTCTTTAatggaaaatttt taattatttagtgagattttatgaatttattttcacaaaaaacTTTWGTT AGGTTCCATCGCCTATAACTTATATGTTGTTAatgctattaataataaaa atgggtatattatattttataggagcagtattttttaagaaaatttcaaa tttatttttatgatatttaatttgtataagatAATAACTTCTAATTTAGC TCTTACTCTCATACTATGaatgattgtaaaataaaaatacaccagttcta ttattattaaatcataactgTTAgagaattgtattttatttaaacacaca CTTGACTAGTAATAAAGAGTTTGAATGTTCGAAAACTGgtgtaactttaa tatttttatcaaaaccaTAAATGTTGAGCGTTGTAACTTAtaaccaatat tattgttaYgaataaacaataatacaatgctagctgataaattattagct tattttaatttaaaattgtcatcgcttaaattgtatgtaatttatgtata actttttatattaagttattagtCATAAGCATAAGCTGcacaactaaata aaataacttgttgaaataaatatttttaattagaaaatagaaaactaaaa aaaaaaaaaatttattttatgtcattaatggaaataaaacatttaatttt gttattcaatTAGGAAGTTCTGTCTATCAggattaattttcaatttaatt taatggcGTTAACATTCGgtgataatatacatactagAACATTTACTCCT CAAGAGTACTTAGTTGAAATTCTAAGTTcagctaaaaacaaaaatataat tatttcattagaaGGTACAACAAATAaggtatttgttattttaaaactca TTCGAGAACTtgcttttaaaatttacaggttagtcataaaaattaaatat taatattaacaatgatcaaatgataaataaattgattttctatAGGAAAT CTGAAAAAAGAAAATGGACTTTACTTGTTTTAGAAGAAACAGAAATTGAT CAGTACATGTTTTCTATTGGACATTTGACAGATTTAAAACCATTAGACAT CAGATCAGTCAATCATttggattttattaattatgaggtttgtattaaat attataatctttttttcctcctaaaaaatgttttaaatattttgattttg gtcTTCCAGGTAATTATTACTACTGAAAACCTATGTTtagaattatttga aaaaaaatatttgcgatTTGACCAGCTTAACTTAGCTATATTCAATAACT GCCAGAAAATAATTCAGGAAAATAGTACttattataaggtatttaaattt tttctaatcagattaattattttgattaaagtaAAAACTCTATAAAACAG ACATCAGTAACAGACTTTTATCACTAAGAGATGTAAGTGCTGCATGTAGT AATGTAGTATGCATATATCGGGTGATTAATTTAATgcaagatattaattt tttgaaagtattaatgtttttgaaaatattcttttcaTGATTTCTAATCC TTTAAAACTAtacttttttctaaaataaatattaaaaaaattaattgtta tcatagtttgaattttgtctttaaaaacagaatatttttttaaggtactt ttatacataaaaatcaaatttaggatgagtatttatgagttataacttct AGACCAAAGCCTGTGAAACAGtggttcttaattttttttagttcatggca cactattatacattacaagTTTGCACAGCACACTCACCAACAAAAATGTA Aggaaataaattactgttttcaatattttttatcagcataaatacaaaaa tcagACATTTCTCGCGTCACAGCGGTTTTGGGAACCACTCCAGTAAAAta ttgatcaatttttttttttggggggggggatcaAGGTCTGGACCTTAAAC CTTCCTGGCTAGTTATAAAAAAGTATCAAAAGTTTGATGTGTGGAGCAGT AAATCAATATTTGGTGAGATAACCTCATACCATtccacttatttaaaatt ttaaatacttaaaagtcaaaaactactcattctaaatttaatttttatgt attgaaatacgagtatttagaaaaatattctgttggaatatgaaattaaa actgaatattGTCTTTCAAAAagataaaaatcttaaaaatgtttggcata aaaaatattttgtattttttagtgGCTAGAAaccatgaacattttttttt aaacatctatacattttgaaataatgagtgttcagtgattaaaaaaatca tccgATATTCAGCATTAGgcatagatataattttatttaatatgtattga tGAAATTTAGGAAATATCTAATCGGAATtcgcatattattttgatagtta TTCTCAAGGTGGCTATAGCCAATAATGAATAAACCCCTGTTCTGTAGGTA GGCCTTGGCAAACAGATGTCTTCAAATAGAGGTTTtactttatagtaaaa taatacgaAAGTAATGTTgaaattctttttatttttttagatttgcaATT TTATCAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTTCATccatta tttgaatttgattcTGATCCATTCTTTATTGaaaatcaattgaaatttat atcacACAAATTGATTTCATCTATCGAGACTGCCAGTGATATTGTTTCTA TATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAATGTGCTATT CACACAGAAGATCTTACCAATATTAAGATAAAGACAATGGTGCAGAGTTT AACTGAATTCTTAAATGACCATAATTATGAGCCTGCTATCATATATGGAG ACGATGAAGAATTTGGTGaagaattaaaacaaatacctaACCCTAAAAAT GAACCTTTACAAATGATAGCTGATTTTTTggagattttaaaaacaatggg TCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATATGGTAGAAA AATTGAAAGTTAAAACTCCATATGAAAGACACTATGTTTTGTTATGTATT GTTTCTACATTATTGATTCAAATAAGAGCCAcatttgatgatatttttta taattatagtaatattgataAAGTACTGAAATTTAGTTCTCCTCGTGTAT TACGAATTATTAATACTCTCAAACAATTTAAACCAAAATCTTTTAAAGCA GATAGTAACAATGTTGAAGTATGTAAagatcaaaaagaaaaaaaagatag aaCTATCAAATCTAAATCAATAAGACGTAATTGGAAATTAGCTAGGAGAT ATGGAACTCATAGAAAACAAGGACGATCAAGAGATCCGTATGAAGAAACT GTTTGTGCTATAATTCTCGTAAACAACAAAATGACAGCttctattttgta ttatttatttttagtaagcatattttattttttatcagttaaattaattt aaaatgaagtaattattttattgtttttatcttcTTTAGGATTTGAAAAA CAGTAACAAAGAAGATTTTGGTTGGATTCAACCTCAATACACAGTAGATA AAGAAGCAGATCCAATTACTGAACCTAAAGAATTTGAAATTGAACATAAA AAGCAAGAAGAAACTTTAAGAAGGTttgattgtatacattttttataaaa gattattttcaataaactgTATTTGattgcaattaataatttagtataaa aatggtTATTTCAGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAAC TAAAGTATTAGAAGCAGGAATTGATTTACCTCGATGTAATTtagtgatta attataatataccacttTCATACAAATCATATCTAAGGTCTAAAAGTAGA GCAAAAACAWTAGAtgctcattatattttaatgtttgacgAAGATGctac ttcaaatattttatctcgTCTTAAACTATATAAAGACATTAACCaggtaa aaattgattttaaataaataaattatttatctaaccaatacataatttaa aatggttttaaattatttttttctagatgTTATTAAATCATTGCACTTTA AAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTATAATTGGTG TGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCATTTGTTGATA TGGCAACAGCCATAGGACTTGtgaataggtattaatttatattattagtt catcatacatttttcataatattttatttgtgtttataacttataagtac taTTTTTATCTGACTGATTAATtcctatgttattataatgattgcattat atttcctaaaatatttataaatgtgttaatataggtattgtgcAAAATTA CCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACAATCAGT AGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTCCAATTA ATTCACCTATTAAACATGATATAcatgtaagtattatttatgcattatag AGAACTAGATTGTCATATTAACTAACTAAGAAACTCTAAATAGCTTATTG AACATAGTGGTGCTATGATGGACTTAAAGTGAAACCTCACACCTACTGGG TACTTAGGTGTGTAGcacatattcaatataataatatttttctcttttaa aacaattttaaatactattgatataaaaaaatgtgaagaaGCAGGTAACA CTGTGCTGTACATAGGTATCATGCGGATCACTGGATGTGTTAAATgtgat ttcaattttataaaattatcttatataaaatgCGGTTCTGAGTAAAGTCA ATCTGttagcctatattataataactaaaaccaCTATTCTCAGTTTAAGA AGCCAATTTCATGTAAATTTTAACTTAGAATatctattgaaaaatattgt gtttatttaattttttgatttttttttctctattcaTATCGACCTATAAG TTTTTTGCAAAAATGTTTGAAAGGCTTATTCTTAAAAGAATTCTGCCATA CATTTCTTCAAGTAACATACTTCCAAATACTCAATTTGGCTTTCTTGTCT CTCATTCCACAACTCATCAACTACATAGATTAGTCGATACCATTTCGTTC TCacttgaaaagaaaaaatactgCTCGTGCGTGTTCCTTGATGTCTCTCA AGCCTTTGATAGGGTTTGGCATGAAGGGCTGTTATATAAACTAAAAGCTT TTCTTCCcccaacatattttttactcattaaaTCTTATTTTGCGGAACGT CACTTTTAAGTCAAGTTTGGCTCTTccttttcaaaaattgaaaaaattag tgCAGGAGTCCCTCAAGGTGGCATTGTTCAccaatactatataatgtata tgcaaCAGACCAACCTACCTCTCCATCAACATCTGTAGCTGAATTTACGG ATGATAAGGCAATTATATCAGTACACGAAGACCCACACATTGTTTCTCTA AatcagcgtttcttaaacttttttatccgtgAAACACTTTTTAATGTCCA CTTTTATCGTGGAACCCCTACTTCTTTTtagctttttagtttttttttag gattatttgcaaataaattataatattaagtagaagtatagattattgaa tatattgagTTATCTGATAGATTATTCCATAtggcttatacattattatt taatatacaagtattattttccataatggatattttaaagtaattttctt gaacatttaaaaaaaattacttaagcttTGCGGAACCCTGAAGTGATCTA CGTGGAACCCCAAGGTTCCGCGgaacacagtttaagaaacgctgctTTAA ATCTTCAAAACCACCTTGACCTAATGTCTGTCTGGTATGAAAAATTGTGA GTTCAAGTCAACCAATCAAAATCCATTCACAGTACGTTCACTCTTCGTCT CCCTTAGTAACATACCAATCCCTTCATCCCATTCGGTTAGGTACTTAGGG CTAACCTTTGACCGTCGCCTCACCTGGGGACTTCATATCAGAACTAAAAA ACTAGCTCTAAACGAACGACTTCGCTCAATTAAAACACTAATATCTAACA AGCATACTAAACACCAAACTTCtcatatataaatcattaattaaggCCTT GTGGACTTATGGCCWACAACTATGGGacaatgcaaaaaaaaactaatgta aataaaatccaaaccgttcaaaataaaatcttaagaTTAATCACTAACGC CCCTCCTTATGTCTCCAACTACACTCTGCACACagatttaaatactaaaa cagTTCACGATGAAGCAATAACATATTGCAAAAGATTCCATAACAGACTT CCATATCATCCTAATCACCTTATATCCAATTTAGCTTCTCGCACAATTCC AGGCAATCCCACCCAACGACTGAAAAGAAAATGGTGTCgagatttacaat ttaaataaataaattaaaattatataaaataaaaagttattaataaacaa ataagtagTGCTTTCACTGGATGGCTTCTTTCCTCACgttttcatgttaa aaaaaatattatatctcacATTTTTATTGTGCTCAAGGCTACAGATTGTA TAttctttgttaaaaaaaaaaaaagatttttgacTTCTACTTATGTGGaa cattgttttcatttttaagagGGCGCAACAACTGTATTTGTTGTGTCAGT CGTAACAAGgcgtaacataataaatttatgctcAGCACTTCACGATTTAT TCCGTTAGCTTAGAAGTTAGAGTGAATAGGCCTTTTAAAAGCGTAACGTA AAACACAGMtaatgtttttaccatcaagtttcataattggtctattcact ctaatttttaagctaacgaaataaaatgtgaactgctgagcataaatttg ttatgttacgcgtttgtaagattGAGACAACAATACGGGTGTTGCACCCT CTTAATTCTTGGTTATAAAACtgaacatcaaaataatttgcaaaatttTT GTGATTCTGATGAATTTTGTTACTAATAACatttggtaattattaattaa gattgATTTAAGCCATTATTCTCATTCCCAATTGatgtaaaataaactat tatagtattatttgattaaatattaatttttaattttttttacagggTCA TCCAATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGT GTAGACAACTTCATTCTCAAGGTGAATTAGATGACACCCTTCAACCTATT ACAAAAGAATCATTTCATGCATTGTTCAATGCTGACGAAGTATTGCCAGA CGCTGAAGATGCATTAATACCTTGGGACACAGAAGAGCCTAGACCTGGAA CAAATAAACGCCGCCAATACTACTATAaaagagtataaataatattttaa acatctaaTATTGAATTGTGTTTTAAAGTAATTTcctaacaattataaaa tttttactagATTGCTGAGGCATTTAATGACTGTAGACCAGTTGAAGGTA AAGCTTGTCATTTATATgctatattgttaaatatgaatTGTCCTGTACCA GAAGAACAAAATACTAGAGGTCGAAGAATTCATCCACCCGAAGAATCCAT TCATGGGTTTGGTATACTTACAATGAAACACATTCCAAgtgtaagtaaat atttataaatgaaaatataatatgtatttatatgtatacttatacaataa gTTCTCGTTTAACTTCTTAGTTAGTTTAGGTtcctaaaaaacaaaacatt atgtgaaataaaatgataaatgaaatattgtttcatttttgtaatgggtg atttACTTAATGATTACTTAAAAAACactgaaaaaatgttttgtctatgt tgagcATGGACCAGAGAGAAAAAACAAATGACTGTGCTTTGACATCCTCT TAAACAACTTATTACCAAAAAAATGAAGAATcaatacgaaatattatgta catatagtataattacaGCCCTCAGAAACACAATGCCAGTCGAGATGATA CCTAGTGTTAGTCTTGAAGGAAATACACCTGGATGGTACGTTGCTACACT GTATAAACTTATTGATTTAAGATAGATATTGggcatagtatattaaattc agGTACAATGTGCATAAACTGGTGCATAGAGACCAACACTGAGGTCCAGA AAAgtctaacttaacctaacctttgGAATATGTAAGATGacttttaatca atattttaatttttaagtgagataatatgagcattttaaataatatttct caaaCCCATTTCttgctttaatattaaaacattgaaaattctACTGTATA CTGTACTCTATAWGCTCTTACCTAAATGTTTGATACTAGATTAATTCACT cttatatcaaatatcaaaactaacagcacactattgaaactagtAAGCCA CATTTGTTatattgtacgtttgtaagacgtaTACAACAAGTGCATAGGTA GTGTCCTTTTAAGAGTGTATGCACTACACACAATTAAATAACATACAGTC CAATATAATAGAAACATTATACTGGAACTATTATACTGTTAAATGGAACA CaaggtattaaaattgtatgacttGATAGAAAAGCAATGTTAAACAAGGa cttactgtatatattatattggttataactttataagttataacttggAA ATCAAATAACTTTTTAGATTCCGCCATTTCCCATATATACTCGATGTGGT GAAGTATATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACA ACATCAACTGGATAATATagccacatttttaaattatacgttCACCAATG TACTACGTTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcat aattgttattatattgtgccAACTCTTCGAGGTTGTATGCATCAAATTAT TGATGGTTATAAAAGCTATAAAATGtgattgatatattatagatacaagt GGATTGATAGACATTGATTGGAAATTCCTAgataatatgcataaatgtaA AGATAATAAACTAAGTATTATAACTAATGAAGATAGAATACATTTTCAAC CTGATATTGAAGTATTGAAAGATGCTGTTGTTACTCCTTGGTATAGAAAT CAAGAACAACCCCAGgtattttctaaacaatttgaatatttataataatt aatcttatttttcTGTTTAGTATTTCTATGTAGCAGAGATTTGTACACAT CTTAATCCAAAATCACCATTTCCTGGTTCTAtagaaaactataaaacatt tgAGGATTACTATTATCTTAAGTATAgattaaaaatccaaaatctTGAAC AACCTCTTTTAGATGTGGATCATACTTCTGCAAGACTTAATTTTCTTACA CCAAGGTTTGCtagtatacataaattataaaaWttttttttatattttaa ttgtttgcaGGTATATGAATCGTAAAGGTGTAATTTTACCTACTAGTAGT GATGCAACTAAAAGAGCTAAACGAGATAATCTAAGTCAAAAACAAATTCT TGTTCCTGAACTTTGTAATGTTCATTTATTTCCAGCATCAATGTGGCGTA AAGCTGTTTCTTTACCATGTATACTATATCGCATTAATGCTTTATTGTTA GCTGATGAAATTCGTACTATTGTTGCCAAGGATATATCTTTAGGATTGGT TAACTTAAGTTTTGGTAAAGACCATAAACTTACTAAATATTTTctgtata ctaattatttttacatttaatagatCACATGTGGGAGCCTTTAGATTTTG GTTGGACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAATT AGTACGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTAGA TGAAAAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTGGA TGGAYATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaataat attgatagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATGAT TCAAAGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGATG GGATTCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTAGA AATACTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaataa attattatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAATG ACAATGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaacaa attatagatttattttataaaaaagatgatgatattattataaatcgagA AGTAAAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACCAT GGGAATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTTTA TCGGATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagtga aatattcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGGTG TGCAATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATCAT CCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAATGC AAATGATggaattaatttggaacgtttGGAAACTATCGgagattcatttt taaaatatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTCAT GAAGGTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAATTT GTATCGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTACAA AATTTGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTCAT AAATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGGAA TATGATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGAAG AAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAAAT ACCCCTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCTGA TAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtggtatagtaaatataa ttatttatcagtatAACCATCAAATTTTTCCTAAAATGTTTCCTTTTCTA GGTGCCTATTTGATATCTTGTGGTGCTCGTggagcattattatttatgtc ttgGCTAGGAATAAAAGTATTACCTACGCTACATGATTCAAAATTAGGTT ATCTAAAACCCCCATCATCTCCAMTTCTACGTAATGTTGACGATCCCGAA GGCGAATTAACAAAGTTGATGGATGGATTTGAATCTTTTGAACAGCATTT AGGATACCATTTTCAAGATCGTAGTTATCTATTACAAGCAATGACTCATG CTTCTTATTACCCCAATCGTTTAACTGATTGTTATCAACGATTAGAGTTT TTGGGTGATGCAGTTTtgggtaaatataaaaagaatataatagttgattt taattctaaatttaatttaaaattttagattatttaattacGCGGCATTT ATATGAAGACAAGCGACAACATTCACCTGGAGCTTTGACAGATCTTCGTT CAGCACTAGTCAATAACACAATTTTTGCATCCCTTGCTGTTAGAAATGGT TTTCATaagtatttcaaacatttatccCCAGGTTTGGCTGAAGTTGTTTG TAGATTTGTAACCATACAAGAAGAGAATGGCCATACTATTGATGAAGagg tacctaactattattcaaacatatatctttatttttattttgctatgcGT ATTTATGGTAAAAGTTgtacttttatgaatttatttaacgtTAAAACTAC ACACATctttaaaacagtatttttagtttaagtattaagactaacatttt aatacaatgttacttatattttattcaatcgaTTTCAAAATTAGTTCATA TAAATACTAGATTTCtacttaaaatcatttttttgtaatcTTCATTGATC AttgatcttaaataataaaatgctggATTAACTTAATTTTGAGTGCTAAT AATGGATTTTCCCACAActcaatgaaatatataaacttttaaaacatttt ttagttttattttttgggaGAAGATGATTGTGAAGAAGCTGAAGACGTTG AAGTGCCAAAAGCCCTTGGTGATGTTTTTGAATCGGTTGCAGGAGCAATT TATTTGGATAGTAATATGTCATTAGATACAGTATGGAaagtttatcataa aataatggaaaatgaAATGGGTaaggttacatattattatgatcacttaa atattatcaatttttttttttaccttaatgcttcaaaaatatgtatttgt ttatgagcaaatttaatgttttagtattttttaaataatttttataagct aTGTTAGTGTAGTTGTAAAAACCAAGTACAGTAGAACTTCGATTAACCGT CACTGTCGGGACCGGGGCTATGACGGTTAATCGAATAGACGGTTAACGga aattttgcaaaaaaaaaaacgtgtacatacatatacacacatttattata ttttttacgtgtgtgtactttaaaaataatacatataaaaaaaatataac atataaattaattattgtaacacATATAAACACGACACATAAACTACGAA AACACTAATACACACGGTACACACTTACACGTAGGCTGTTCGTCGGTCAc tgattaaattacaatacatacatacatagtacaatacatacacacataaa ttTATAGTTCGTTTATCACATTTATCGCTTATATtggatatgtatatatt acaaactatttttatacacttGATAGTTACTGTGTTGGGCACCACGACGA GTTTATCACAATcgtctaattattttttttttcggcgaTGACCGATGACG GATAACAGAGAGTGACGGTAGTTctactgtattattaaatattaaaaata gtttatataatacaaaacaaatacttaaatatttaaaaattgtttctctG AGTGAAgcatcttaattattatattaaaacatttaaaatggctaaaaaaa tagtatgtggTGTCAACACAAGCATTATGCTTAAAGGGGAGTTGAAAACA TGTATTTAAAACacatatgacaattttttttttagtcattaaaCCAACCT ACCTACCCACCAGAACCGcttacaaactaaaaattatattcttcaaAACG ATATAGAACAGTTAatgatctattattttattctatagtccctttttttt aaacattatagctactacctagtacctacccaCCCATTTATTTAGCTATG ACATTTGTCATAGGCAAAACCTACTTTTRGCGTCCCTGAATGGcctgaat attaataaatatgtaccttAAACAAGCCTCAAGTAGTGAAAACTATTAAt taccaataattaatataataattaattactaaatgcttgatatttattat agttaatgtttttaattttataaataaatgcttgaatatatgttatatgt tattatttatgttatagaaCAATTTAGTAAAAACGTACCGAAATCTCCTA TCAGAGAACTTCTAGAATTAGAACCAGAAACTGCAAAATTTAGGTgagta acatttaaaaaataatatcaaaaaattgttatttggtAGGAACATAGTAC TAGTGTAGGTTTGCTACATAGaaagtgcatattatatgtcatttgaatat tttttttcagttacatAATTTAAAGATGATGGAAACATGGGTTAATTYGA TATACTTAGTGCGATTTAACTTATTAGCATGAGAGATTTTgaccatacaa tttttttgtctatgcatacattatttttttaataatattgagtacTTATG AACAATTGTATAGAAGAGGTTTTGAGCATAGGCACAAATAGGGAGGGGGG CTTTAGGAGCTAAGGCCCCTAACTAAACCTttcttaaatgttatattaag cttattaaatattagtaaaattaggTTTTAAACCCCCGGGGGGCCATATC TCAAACACTATTTGCGCATATGGCTTCTgagattttgttatatttagtag aactattttttttatcaactataaagtatattttatYatttatattcaaa attatttacggtatggaataattaattttacttattcccaaatattttat tataacgttaATAGAGTCAAACAACATTTGACCTAAAAACATTTTGGAGA CCGATTATGCTAAATTGTTatgctattaaaaaaagttgttgTTTGTAGTA GAGTACATGCATATAACCTAATAATCAGAAAATGTGTTAATTtcttagta tatttaatattataaaagatggATTTTTTTCTATTRTTTCTAGTAAACCT GAAAAGTTGGCAGATGGTCGACGAGTTCGGGTTGTAGTTGAAATATTTGG CAAAGGAGAATTTAAAGGTATTGGTCGTAATTATAGAATCGCTAAATGTA CAGCGGCCAAATGTGCCTTAAAGCATCTAAAGAAAAAGATAAAGAAATAG ATCATAATCTATGTACTTTACATTATACAGTATTRATTGGAAACAAGTAC ATAAAGCGATATCtgttaaagaataaaatttattttgtagttaataaagt aatacattcaattgttgatt
back to top

Coding sequence (CDS) from alignment at JOTR01000065:692291..707460+

>rna3668 ID=rna3668|Name=XM_015507627.1|organism=Diuraphis noxia|type=CDS|length=5523bp|location=Sequence derived from alignment at JOTR01000065:692291..707460+ (Diuraphis noxia)
TAAACCTGAAAAGTTGGCAGATGGTCGACGAGTTCGGGTTGTAGTTGAAA
TATTTGGCAAAGGAGAATTTAAAGGTATTGGTCGTAATTATAGAATCGCT
AAATGTACAGCGGCCAAATGTGCCTTAAAGCATCTAAAGAAAAAGATAAA
GAAATAGaaCAATTTAGTAAAAACGTACCGAAATCTCCTATCAGAGAACT
TCTAGAATTAGAACCAGAAACTGCAAAATTTAGttttattttttgggaGA
AGATGATTGTGAAGAAGCTGAAGACGTTGAAGTGCCAAAAGCCCTTGGTG
ATGTTTTTGAATCGGTTGCAGGAGCAATTTATTTGGATAGTAATATGTCA
TTAGATACAGTATGGAaagtttatcataaaataatggaaaatgaAATGGa
ttatttaattacGCGGCATTTATATGAAGACAAGCGACAACATTCACCTG
GAGCTTTGACAGATCTTCGTTCAGCACTAGTCAATAACACAATTTTTGCA
TCCCTTGCTGTTAGAAATGGTTTTCATaagtatttcaaacatttatccCC
AGGTTTGGCTGAAGTTGTTTGTAGATTTGTAACCATACAAGAAGAGAATG
GCCATACTATTGATGAAGagGTGCCTATTTGATATCTTGTGGTGCTCGTg
gagcattattatttatgtcttgGCTAGGAATAAAAGTATTACCTACGCTA
CATGATTCAAAATTAGGTTATCTAAAACCCCCATCATCTCCAMTTCTACG
TAATGTTGACGATCCCGAAGGCGAATTAACAAAGTTGATGGATGGATTTG
AATCTTTTGAACAGCATTTAGGATACCATTTTCAAGATCGTAGTTATCTA
TTACAAGCAATGACTCATGCTTCTTATTACCCCAATCGTTTAACTGATTG
TTATCAACGATTAGAGTTTTTGGGTGATGCAGTTTtggatCACATGTGGG
AGCCTTTAGATTTTGGTTGGACCATGAaagatgtattaataaaaagaaaa
gaacAAAAAGAAATTAGTACGATAAAAGTTGCTGAACCAGTTGAAACTGT
TAAGCAACTTGTAGATGAAAAGATAAAAGAAGAAAAGATAGATAAATCAG
ATGATCCTAATTGGATGGAYATTGGAACATGGTCTAATGATATGGCTGAC
TTtgcaatgaataatattgatagtaCGACAAAAGTAAGGTATTCATCACC
TACTAGTTGGATGATTCAAAGTGATAATGAATCAAGCACGTTCAGTGATC
TTGATTCAGATGATGGGATTCAAGTTAATGGTTTACACTCTAATGGTTTA
CGAATAGAATTTAGAAATACTTATTTAGCTGAAGCTGTGGATGAAAATGA
ttccaaaacaaataaattattatttttccaaaacaaTGAAACTCCTCAAT
TGTGGACTTGGAATGACAATGGTCACTCTGTAACTGAATATAATTCTAAT
CAACAAGACAaacaaattatagatttattttataaaaaagatgatgatat
tattataaatcgagAAGTAAAAAGTAGTACCAATATTGACAGCTTATCTT
TATTAAAACTACCATGGGAATTAAATGCAAATACTGGTTATGGACTTTCA
GACATCAATGTTTTATCGGATAAAACTTCATTTATCCCTGAAgatgataa
tgatattaaaagtgaaatattcataaaaaataaaacattcgatAGTGTCA
ATAAAGTTCATGGTGTGCAATCTGAAACATTTAGTTTTGATTTTCAGCCA
GACTTAAACAATCATCCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATT
AACTATGTCAAATGCAAATGATggaattaatttggaacgtttGGAAACTA
TCGgagattcatttttaaaatatgccaTTACAGCTTACTTATACTGTACC
CATGATAATGTTCATGAAGGTAAATTGAGCCATCTTAGATCAAAACAAGT
CAGTAATTTGAATTTGTATCGTCTTggtaaactaaaaatgtttggCGAAC
GTATGATATCTACAAAATTTGAACCTCATGATAATTGGTTACCACCTTGT
TATTTTGTCCCTCATAAATTAGAAAAAGCTCTTATTAGTGCTAGTATACC
AACAACTTTATGGAATATGATAACACTTCCCACATTTAAGGATCCTACAG
ATAAAGAAATTGAAGAAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAAT
GAGGACAAAGAAAATACCCCTTTATTTGTGCCATACAACCTTGTTACTCA
ACATAGTATTCCTGATAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtg
GTATATGAATCGTAAAGGTGTAATTTTACCTACTAGTAGTGATGCAACTA
AAAGAGCTAAACGAGATAATCTAAGTCAAAAACAAATTCTTGTTCCTGAA
CTTTGTAATGTTCATTTATTTCCAGCATCAATGTGGCGTAAAGCTGTTTC
TTTACCATGTATACTATATCGCATTAATGCTTTATTGTTAGCTGATGAAA
TTCGTACTATTGTTGCCAAGGATATATCTTTAGGATTGGTTAACTTAAGT
TTTGTATTTCTATGTAGCAGAGATTTGTACACATCTTAATCCAAAATCAC
CATTTCCTGGTTCTAtagaaaactataaaacatttgAGGATTACTATTAT
CTTAAGTATAgattaaaaatccaaaatctTGAACAACCTCTTTTAGATGT
GGATCATACTTCTGCAAGACTTAATTTTCTTACACCAAGatacaagtGGA
TTGATAGACATTGATTGGAAATTCCTAgataatatgcataaatgtaAAGA
TAATAAACTAAGTATTATAACTAATGAAGATAGAATACATTTTCAACCTG
ATATTGAAGTATTGAAAGATGCTGTTGTTACTCCTTGGTATAGAAATCAA
GAACAACCCCAGATTCCGCCATTTCCCATATATACTCGATGTGGTGAAGT
ATATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACAACATC
AACTGGATAATATagccacatttttaaattatacgttCACCAATGTACTA
CGTTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcataattg
ttattatattgtgccAACTCTTCGAGATTGCTGAGGCATTTAATGACTGT
AGACCAGTTGAAGGTAAAGCTTGTCATTTATATgctatattgttaaatat
gaatTGTCCTGTACCAGAAGAACAAAATACTAGAGGTCGAAGAATTCATC
CACCCGAAGAATCCATTCATGGGTTTGGTATACTTACAATGAAACACATT
CCAAgtggTCATCCAATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGC
ATTAGAAGTGTGTAGACAACTTCATTCTCAAGGTGAATTAGATGACACCC
TTCAACCTATTACAAAAGAATCATTTCATGCATTGTTCAATGCTGACGAA
GTATTGCCAGACGCTGAAGATGCATTAATACCTTGGGACACAGAAGAGCC
TAGACCTGGAACAAATAAACGCCGCCAATACTACTATAaaagagtattgt
gcAAAATTACCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGAT
ACAATCAGTAGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGAC
TTCCAATTAATTCACCTATTAAACATGATATAcatatgTTATTAAATCAT
TGCACTTTAAAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTA
TAATTGGTGTGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCAT
TTGTTGATATGGCAACAGCCATAGGACTTGtgaatagGTTTCGACAAAGA
GAATGTAATGTACTTATTGGAACTAAAGTATTAGAAGCAGGAATTGATTT
ACCTCGATGTAATTtagtgattaattataatataccacttTCATACAAAT
CATATCTAAGGTCTAAAAGTAGAGCAAAAACAWTAGAtgctcattatatt
ttaatgtttgacgAAGATGctacttcaaatattttatctcgTCTTAAACT
ATATAAAGACATTAACCagGATTTGAAAAACAGTAACAAAGAAGATTTTG
GTTGGATTCAACCTCAATACACAGTAGATAAAGAAGCAGATCCAATTACT
GAACCTAAAGAATTTGAAATTGAACATAAAAAGCAAGAAGAAACTTTAAG
AAGatttgcaATTTTATCAAGCCAAATAGTAAATGTAGAATATTGGGTAT
TGTTCATccattatttgaatttgattcTGATCCATTCTTTATTGaaaatc
aattgaaatttatatcacACAAATTGATTTCATCTATCGAGACTGCCAGT
GATATTGTTTCTATATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCAT
TGAATGTGCTATTCACACAGAAGATCTTACCAATATTAAGATAAAGACAA
TGGTGCAGAGTTTAACTGAATTCTTAAATGACCATAATTATGAGCCTGCT
ATCATATATGGAGACGATGAAGAATTTGGTGaagaattaaaacaaatacc
taACCCTAAAAATGAACCTTTACAAATGATAGCTGATTTTTTggagattt
taaaaacaatgggTCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTG
TATATGGTAGAAAAATTGAAAGTTAAAACTCCATATGAAAGACACTATGT
TTTGTTATGTATTGTTTCTACATTATTGATTCAAATAAGAGCCAcatttg
atgatattttttataattatagtaatattgataAAGTACTGAAATTTAGT
TCTCCTCGTGTATTACGAATTATTAATACTCTCAAACAATTTAAACCAAA
ATCTTTTAAAGCAGATAGTAACAATGTTGAAGTATGTAAagatcaaaaag
aaaaaaaagatagaaCTATCAAATCTAAATCAATAAGACGTAATTGGAAA
TTAGCTAGGAGATATGGAACTCATAGAAAACAAGGACGATCAAGAGATCC
GTATGAAGAAACTGTTTGTGCTATAATTCTCGTAAACAACAAAATGACAG
CttctattttgtattatttatttttaGTAATTATTACTACTGAAAACCTA
TGTTtagaattatttgaaaaaaaatatttgcgatTTGACCAGCTTAACTT
AGCTATATTCAATAACTGCCAGAAAATAATTCAGGAAAATAGTACttatt
ataagGAAATCTGAAAAAAGAAAATGGACTTTACTTGTTTTAGAAGAAAC
AGAAATTGATCAGTACATGTTTTCTATTGGACATTTGACAGATTTAAAAC
CATTAGACATCAGATCAGTCAATCATttggattttattaattatgagatg
gcGTTAACATTCGgtgataatatacatactagAACATTTACTCCTCAAGA
GTACTTAGTTGAAATTCTAAGTTcagctaaaaacaaaaatataattattt
cattagaaGGTACAACAAATAaggtatttgttattttaaaactcaTTCGA
GAACTtgcttttaaaatttacag
back to top