rna3669 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507628.1
Unique Namerna3669
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:692291..707460 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507628.1
Productendoribonuclease Dcr-1, transcript variant X2
Model evidenceSupporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161280
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507628.1
GeneID107161280
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161280gene2480Diuraphis noxiageneJOTR01000065 692291..707460 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507628.1rna3669Diuraphis noxiapolypeptideJOTR01000065 692714..707340 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32074id32074Diuraphis noxiaexonJOTR01000065 692291..692715 +
id32075id32075Diuraphis noxiaexonJOTR01000065 693886..694027 +
id32076id32076Diuraphis noxiaexonJOTR01000065 694100..694228 +
id32077id32077Diuraphis noxiaexonJOTR01000065 695431..696303 +
id32078id32078Diuraphis noxiaexonJOTR01000065 696380..696513 +
id32079id32079Diuraphis noxiaexonJOTR01000065 696605..696836 +
id32080id32080Diuraphis noxiaexonJOTR01000065 696917..697068 +
id32081id32081Diuraphis noxiaexonJOTR01000065 697225..697366 +
id32082id32082Diuraphis noxiaexonJOTR01000065 699986..700222 +
id32083id32083Diuraphis noxiaexonJOTR01000065 700301..700480 +
id32084id32084Diuraphis noxiaexonJOTR01000065 701508..701721 +
id32085id32085Diuraphis noxiaexonJOTR01000065 701783..701955 +
id32086id32086Diuraphis noxiaexonJOTR01000065 702011..702195 +
id32087id32087Diuraphis noxiaexonJOTR01000065 702251..702504 +
id32088id32088Diuraphis noxiaexonJOTR01000065 702564..703925 +
id32089id32089Diuraphis noxiaexonJOTR01000065 703992..704309 +
id32090id32090Diuraphis noxiaexonJOTR01000065 704369..704589 +
id32091id32091Diuraphis noxiaexonJOTR01000065 704945..705110 +
id32092id32092Diuraphis noxiaexonJOTR01000065 706358..706433 +
id32093id32093Diuraphis noxiaexonJOTR01000065 707184..707460 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363114.1cds3571Diuraphis noxiaCDSJOTR01000065 707184..707340 +


Sequences
The following sequences are available for this feature:

protein sequence of XM_015507628.1

>rna3669 ID=rna3669|Name=XM_015507628.1|organism=Diuraphis noxia|type=polypeptide|length=1783bp
MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVI
ITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNS
KCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCC
KPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFG
EELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKT
PYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINT
LKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRK
QGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYT
VDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPR
CNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYK
DINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAI
GLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHD
IHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADE
VLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLY
AILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTR
CGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTT
THNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPD
IEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDY
YYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKR
AKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIR
TIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEP
VETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVR
YSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAV
DENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKK
DDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIP
EDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVL
LQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLR
SKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALIS
ASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYN
LVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDS
KLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQA
MTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLR
SALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEE
FYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKI
MENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFG
KGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK.
back to top

mRNA from alignment at JOTR01000065:692291..707460+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3669 ID=rna3669|Name=XM_015507628.1|organism=Diuraphis noxia|type=mRNA|length=15170bp|location=Sequence derived from alignment at JOTR01000065:692291..707460+ (Diuraphis noxia)
CAGACAATAGACATTAAACAaactaaacattaaacaaaaacaaaaacaaa gtgAAAAACATGTCTAAAGTTGCAGATTTCCTGTTATTTGTTATTCTTAT TCCTTAAATAACCAGTAATCCTGACTCCtttcatattatacttgtttata ACTCCTTTGAAGTCGTACACTACAACAAAAAGTGCGTTTAGCCGTCTTCC ATCGGTCCATAGTTCAGACGTCCACCAGTCTACATAAATTCCAATGTATT TAGTTTCAAGAATCTAATgatcttttaaataataacaatcatataactat ttttaataatatgaagcattactaatattatcttaatttagtttcaataa tgaagttaataatattttagaaattgaatttatttttattggagaGAGAC TTTATTCATCAGtgacaatatttatgtatgtataattttttgttatttga ataaaagaaaaagataatattttttttaaggtccACCTACCtacttgaat aattaaataattattttgataaaaaataatttttgtttgtttttatatat acatatatgtaaatgTACATACTTTTAGTACCTATGACCAGTGGTAACAA ATTCATAAATCATGTGAAGCGATTGCTTGACTTCTTTAatggaaaatttt taattatttagtgagattttatgaatttattttcacaaaaaacTTTWGTT AGGTTCCATCGCCTATAACTTATATGTTGTTAatgctattaataataaaa atgggtatattatattttataggagcagtattttttaagaaaatttcaaa tttatttttatgatatttaatttgtataagatAATAACTTCTAATTTAGC TCTTACTCTCATACTATGaatgattgtaaaataaaaatacaccagttcta ttattattaaatcataactgTTAgagaattgtattttatttaaacacaca CTTGACTAGTAATAAAGAGTTTGAATGTTCGAAAACTGgtgtaactttaa tatttttatcaaaaccaTAAATGTTGAGCGTTGTAACTTAtaaccaatat tattgttaYgaataaacaataatacaatgctagctgataaattattagct tattttaatttaaaattgtcatcgcttaaattgtatgtaatttatgtata actttttatattaagttattagtCATAAGCATAAGCTGcacaactaaata aaataacttgttgaaataaatatttttaattagaaaatagaaaactaaaa aaaaaaaaaatttattttatgtcattaatggaaataaaacatttaatttt gttattcaatTAGGAAGTTCTGTCTATCAggattaattttcaatttaatt taatggcGTTAACATTCGgtgataatatacatactagAACATTTACTCCT CAAGAGTACTTAGTTGAAATTCTAAGTTcagctaaaaacaaaaatataat tatttcattagaaGGTACAACAAATAaggtatttgttattttaaaactca TTCGAGAACTtgcttttaaaatttacaggttagtcataaaaattaaatat taatattaacaatgatcaaatgataaataaattgattttctatAGGAAAT CTGAAAAAAGAAAATGGACTTTACTTGTTTTAGAAGAAACAGAAATTGAT CAGTACATGTTTTCTATTGGACATTTGACAGATTTAAAACCATTAGACAT CAGATCAGTCAATCATttggattttattaattatgaggtttgtattaaat attataatctttttttcctcctaaaaaatgttttaaatattttgattttg gtcTTCCAGGTAATTATTACTACTGAAAACCTATGTTtagaattatttga aaaaaaatatttgcgatTTGACCAGCTTAACTTAGCTATATTCAATAACT GCCAGAAAATAATTCAGGAAAATAGTACttattataaggtatttaaattt tttctaatcagattaattattttgattaaagtaAAAACTCTATAAAACAG ACATCAGTAACAGACTTTTATCACTAAGAGATGTAAGTGCTGCATGTAGT AATGTAGTATGCATATATCGGGTGATTAATTTAATgcaagatattaattt tttgaaagtattaatgtttttgaaaatattcttttcaTGATTTCTAATCC TTTAAAACTAtacttttttctaaaataaatattaaaaaaattaattgtta tcatagtttgaattttgtctttaaaaacagaatatttttttaaggtactt ttatacataaaaatcaaatttaggatgagtatttatgagttataacttct AGACCAAAGCCTGTGAAACAGtggttcttaattttttttagttcatggca cactattatacattacaagTTTGCACAGCACACTCACCAACAAAAATGTA Aggaaataaattactgttttcaatattttttatcagcataaatacaaaaa tcagACATTTCTCGCGTCACAGCGGTTTTGGGAACCACTCCAGTAAAAta ttgatcaatttttttttttggggggggggatcaAGGTCTGGACCTTAAAC CTTCCTGGCTAGTTATAAAAAAGTATCAAAAGTTTGATGTGTGGAGCAGT AAATCAATATTTGGTGAGATAACCTCATACCATtccacttatttaaaatt ttaaatacttaaaagtcaaaaactactcattctaaatttaatttttatgt attgaaatacgagtatttagaaaaatattctgttggaatatgaaattaaa actgaatattGTCTTTCAAAAagataaaaatcttaaaaatgtttggcata aaaaatattttgtattttttagtgGCTAGAAaccatgaacattttttttt aaacatctatacattttgaaataatgagtgttcagtgattaaaaaaatca tccgATATTCAGCATTAGgcatagatataattttatttaatatgtattga tGAAATTTAGGAAATATCTAATCGGAATtcgcatattattttgatagtta TTCTCAAGGTGGCTATAGCCAATAATGAATAAACCCCTGTTCTGTAGGTA GGCCTTGGCAAACAGATGTCTTCAAATAGAGGTTTtactttatagtaaaa taatacgaAAGTAATGTTgaaattctttttatttttttagatttgcaATT TTATCAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTTCATccatta tttgaatttgattcTGATCCATTCTTTATTGaaaatcaattgaaatttat atcacACAAATTGATTTCATCTATCGAGACTGCCAGTGATATTGTTTCTA TATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAATGTGCTATT CACACAGAAGATCTTACCAATATTAAGATAAAGACAATGGTGCAGAGTTT AACTGAATTCTTAAATGACCATAATTATGAGCCTGCTATCATATATGGAG ACGATGAAGAATTTGGTGaagaattaaaacaaatacctaACCCTAAAAAT GAACCTTTACAAATGATAGCTGATTTTTTggagattttaaaaacaatggg TCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATATGGTAGAAA AATTGAAAGTTAAAACTCCATATGAAAGACACTATGTTTTGTTATGTATT GTTTCTACATTATTGATTCAAATAAGAGCCAcatttgatgatatttttta taattatagtaatattgataAAGTACTGAAATTTAGTTCTCCTCGTGTAT TACGAATTATTAATACTCTCAAACAATTTAAACCAAAATCTTTTAAAGCA GATAGTAACAATGTTGAAGTATGTAAagatcaaaaagaaaaaaaagatag aaCTATCAAATCTAAATCAATAAGACGTAATTGGAAATTAGCTAGGAGAT ATGGAACTCATAGAAAACAAGGACGATCAAGAGATCCGTATGAAGAAACT GTTTGTGCTATAATTCTCGTAAACAACAAAATGACAGCttctattttgta ttatttatttttagtaagcatattttattttttatcagttaaattaattt aaaatgaagtaattattttattgtttttatcttcTTTAGGATTTGAAAAA CAGTAACAAAGAAGATTTTGGTTGGATTCAACCTCAATACACAGTAGATA AAGAAGCAGATCCAATTACTGAACCTAAAGAATTTGAAATTGAACATAAA AAGCAAGAAGAAACTTTAAGAAGGTttgattgtatacattttttataaaa gattattttcaataaactgTATTTGattgcaattaataatttagtataaa aatggtTATTTCAGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAAC TAAAGTATTAGAAGCAGGAATTGATTTACCTCGATGTAATTtagtgatta attataatataccacttTCATACAAATCATATCTAAGGTCTAAAAGTAGA GCAAAAACAWTAGAtgctcattatattttaatgtttgacgAAGATGctac ttcaaatattttatctcgTCTTAAACTATATAAAGACATTAACCaggtaa aaattgattttaaataaataaattatttatctaaccaatacataatttaa aatggttttaaattatttttttctagatgTTATTAAATCATTGCACTTTA AAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTATAATTGGTG TGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCATTTGTTGATA TGGCAACAGCCATAGGACTTGtgaataggtattaatttatattattagtt catcatacatttttcataatattttatttgtgtttataacttataagtac taTTTTTATCTGACTGATTAATtcctatgttattataatgattgcattat atttcctaaaatatttataaatgtgttaatataggtattgtgcAAAATTA CCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACAATCAGT AGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTCCAATTA ATTCACCTATTAAACATGATATAcatgtaagtattatttatgcattatag AGAACTAGATTGTCATATTAACTAACTAAGAAACTCTAAATAGCTTATTG AACATAGTGGTGCTATGATGGACTTAAAGTGAAACCTCACACCTACTGGG TACTTAGGTGTGTAGcacatattcaatataataatatttttctcttttaa aacaattttaaatactattgatataaaaaaatgtgaagaaGCAGGTAACA CTGTGCTGTACATAGGTATCATGCGGATCACTGGATGTGTTAAATgtgat ttcaattttataaaattatcttatataaaatgCGGTTCTGAGTAAAGTCA ATCTGttagcctatattataataactaaaaccaCTATTCTCAGTTTAAGA AGCCAATTTCATGTAAATTTTAACTTAGAATatctattgaaaaatattgt gtttatttaattttttgatttttttttctctattcaTATCGACCTATAAG TTTTTTGCAAAAATGTTTGAAAGGCTTATTCTTAAAAGAATTCTGCCATA CATTTCTTCAAGTAACATACTTCCAAATACTCAATTTGGCTTTCTTGTCT CTCATTCCACAACTCATCAACTACATAGATTAGTCGATACCATTTCGTTC TCacttgaaaagaaaaaatactgCTCGTGCGTGTTCCTTGATGTCTCTCA AGCCTTTGATAGGGTTTGGCATGAAGGGCTGTTATATAAACTAAAAGCTT TTCTTCCcccaacatattttttactcattaaaTCTTATTTTGCGGAACGT CACTTTTAAGTCAAGTTTGGCTCTTccttttcaaaaattgaaaaaattag tgCAGGAGTCCCTCAAGGTGGCATTGTTCAccaatactatataatgtata tgcaaCAGACCAACCTACCTCTCCATCAACATCTGTAGCTGAATTTACGG ATGATAAGGCAATTATATCAGTACACGAAGACCCACACATTGTTTCTCTA AatcagcgtttcttaaacttttttatccgtgAAACACTTTTTAATGTCCA CTTTTATCGTGGAACCCCTACTTCTTTTtagctttttagtttttttttag gattatttgcaaataaattataatattaagtagaagtatagattattgaa tatattgagTTATCTGATAGATTATTCCATAtggcttatacattattatt taatatacaagtattattttccataatggatattttaaagtaattttctt gaacatttaaaaaaaattacttaagcttTGCGGAACCCTGAAGTGATCTA CGTGGAACCCCAAGGTTCCGCGgaacacagtttaagaaacgctgctTTAA ATCTTCAAAACCACCTTGACCTAATGTCTGTCTGGTATGAAAAATTGTGA GTTCAAGTCAACCAATCAAAATCCATTCACAGTACGTTCACTCTTCGTCT CCCTTAGTAACATACCAATCCCTTCATCCCATTCGGTTAGGTACTTAGGG CTAACCTTTGACCGTCGCCTCACCTGGGGACTTCATATCAGAACTAAAAA ACTAGCTCTAAACGAACGACTTCGCTCAATTAAAACACTAATATCTAACA AGCATACTAAACACCAAACTTCtcatatataaatcattaattaaggCCTT GTGGACTTATGGCCWACAACTATGGGacaatgcaaaaaaaaactaatgta aataaaatccaaaccgttcaaaataaaatcttaagaTTAATCACTAACGC CCCTCCTTATGTCTCCAACTACACTCTGCACACagatttaaatactaaaa cagTTCACGATGAAGCAATAACATATTGCAAAAGATTCCATAACAGACTT CCATATCATCCTAATCACCTTATATCCAATTTAGCTTCTCGCACAATTCC AGGCAATCCCACCCAACGACTGAAAAGAAAATGGTGTCgagatttacaat ttaaataaataaattaaaattatataaaataaaaagttattaataaacaa ataagtagTGCTTTCACTGGATGGCTTCTTTCCTCACgttttcatgttaa aaaaaatattatatctcacATTTTTATTGTGCTCAAGGCTACAGATTGTA TAttctttgttaaaaaaaaaaaaagatttttgacTTCTACTTATGTGGaa cattgttttcatttttaagagGGCGCAACAACTGTATTTGTTGTGTCAGT CGTAACAAGgcgtaacataataaatttatgctcAGCACTTCACGATTTAT TCCGTTAGCTTAGAAGTTAGAGTGAATAGGCCTTTTAAAAGCGTAACGTA AAACACAGMtaatgtttttaccatcaagtttcataattggtctattcact ctaatttttaagctaacgaaataaaatgtgaactgctgagcataaatttg ttatgttacgcgtttgtaagattGAGACAACAATACGGGTGTTGCACCCT CTTAATTCTTGGTTATAAAACtgaacatcaaaataatttgcaaaatttTT GTGATTCTGATGAATTTTGTTACTAATAACatttggtaattattaattaa gattgATTTAAGCCATTATTCTCATTCCCAATTGatgtaaaataaactat tatagtattatttgattaaatattaatttttaattttttttacagggTCA TCCAATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGT GTAGACAACTTCATTCTCAAGGTGAATTAGATGACACCCTTCAACCTATT ACAAAAGAATCATTTCATGCATTGTTCAATGCTGACGAAGTATTGCCAGA CGCTGAAGATGCATTAATACCTTGGGACACAGAAGAGCCTAGACCTGGAA CAAATAAACGCCGCCAATACTACTATAaaagagtataaataatattttaa acatctaaTATTGAATTGTGTTTTAAAGTAATTTcctaacaattataaaa tttttactagATTGCTGAGGCATTTAATGACTGTAGACCAGTTGAAGGTA AAGCTTGTCATTTATATgctatattgttaaatatgaatTGTCCTGTACCA GAAGAACAAAATACTAGAGGTCGAAGAATTCATCCACCCGAAGAATCCAT TCATGGGTTTGGTATACTTACAATGAAACACATTCCAAgtgtaagtaaat atttataaatgaaaatataatatgtatttatatgtatacttatacaataa gTTCTCGTTTAACTTCTTAGTTAGTTTAGGTtcctaaaaaacaaaacatt atgtgaaataaaatgataaatgaaatattgtttcatttttgtaatgggtg atttACTTAATGATTACTTAAAAAACactgaaaaaatgttttgtctatgt tgagcATGGACCAGAGAGAAAAAACAAATGACTGTGCTTTGACATCCTCT TAAACAACTTATTACCAAAAAAATGAAGAATcaatacgaaatattatgta catatagtataattacaGCCCTCAGAAACACAATGCCAGTCGAGATGATA CCTAGTGTTAGTCTTGAAGGAAATACACCTGGATGGTACGTTGCTACACT GTATAAACTTATTGATTTAAGATAGATATTGggcatagtatattaaattc agGTACAATGTGCATAAACTGGTGCATAGAGACCAACACTGAGGTCCAGA AAAgtctaacttaacctaacctttgGAATATGTAAGATGacttttaatca atattttaatttttaagtgagataatatgagcattttaaataatatttct caaaCCCATTTCttgctttaatattaaaacattgaaaattctACTGTATA CTGTACTCTATAWGCTCTTACCTAAATGTTTGATACTAGATTAATTCACT cttatatcaaatatcaaaactaacagcacactattgaaactagtAAGCCA CATTTGTTatattgtacgtttgtaagacgtaTACAACAAGTGCATAGGTA GTGTCCTTTTAAGAGTGTATGCACTACACACAATTAAATAACATACAGTC CAATATAATAGAAACATTATACTGGAACTATTATACTGTTAAATGGAACA CaaggtattaaaattgtatgacttGATAGAAAAGCAATGTTAAACAAGGa cttactgtatatattatattggttataactttataagttataacttggAA ATCAAATAACTTTTTAGATTCCGCCATTTCCCATATATACTCGATGTGGT GAAGTATATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACA ACATCAACTGGATAATATagccacatttttaaattatacgttCACCAATG TACTACGTTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcat aattgttattatattgtgccAACTCTTCGAGGTTGTATGCATCAAATTAT TGATGGTTATAAAAGCTATAAAATGtgattgatatattatagatacaagt GGATTGATAGACATTGATTGGAAATTCCTAgataatatgcataaatgtaA AGATAATAAACTAAGTATTATAACTAATGAAGATAGAATACATTTTCAAC CTGATATTGAAGTATTGAAAGATGCTGTTGTTACTCCTTGGTATAGAAAT CAAGAACAACCCCAGgtattttctaaacaatttgaatatttataataatt aatcttatttttcTGTTTAGTATTTCTATGTAGCAGAGATTTGTACACAT CTTAATCCAAAATCACCATTTCCTGGTTCTAtagaaaactataaaacatt tgAGGATTACTATTATCTTAAGTATAgattaaaaatccaaaatctTGAAC AACCTCTTTTAGATGTGGATCATACTTCTGCAAGACTTAATTTTCTTACA CCAAGGTTTGCtagtatacataaattataaaaWttttttttatattttaa ttgtttgcaGGTATATGAATCGTAAAGGTGTAATTTTACCTACTAGTAGT GATGCAACTAAAAGAGCTAAACGAGATAATCTAAGTCAAAAACAAATTCT TGTTCCTGAACTTTGTAATGTTCATTTATTTCCAGCATCAATGTGGCGTA AAGCTGTTTCTTTACCATGTATACTATATCGCATTAATGCTTTATTGTTA GCTGATGAAATTCGTACTATTGTTGCCAAGGATATATCTTTAGGATTGGT TAACTTAAGTTTTGGTAAAGACCATAAACTTACTAAATATTTTctgtata ctaattatttttacatttaatagatCACATGTGGGAGCCTTTAGATTTTG GTTGGACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAATT AGTACGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTAGA TGAAAAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTGGA TGGAYATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaataat attgatagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATGAT TCAAAGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGATG GGATTCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTAGA AATACTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaataa attattatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAATG ACAATGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaacaa attatagatttattttataaaaaagatgatgatattattataaatcgagA AGTAAAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACCAT GGGAATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTTTA TCGGATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagtga aatattcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGGTG TGCAATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATCAT CCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAATGC AAATGATggaattaatttggaacgtttGGAAACTATCGgagattcatttt taaaatatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTCAT GAAGGTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAATTT GTATCGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTACAA AATTTGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTCAT AAATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGGAA TATGATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGAAG AAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAAAT ACCCCTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCTGA TAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtggtatagtaaatataa ttatttatcagtatAACCATCAAATTTTTCCTAAAATGTTTCCTTTTCTA GGTGCCTATTTGATATCTTGTGGTGCTCGTggagcattattatttatgtc ttgGCTAGGAATAAAAGTATTACCTACGCTACATGATTCAAAATTAGGTT ATCTAAAACCCCCATCATCTCCAMTTCTACGTAATGTTGACGATCCCGAA GGCGAATTAACAAAGTTGATGGATGGATTTGAATCTTTTGAACAGCATTT AGGATACCATTTTCAAGATCGTAGTTATCTATTACAAGCAATGACTCATG CTTCTTATTACCCCAATCGTTTAACTGATTGTTATCAACGATTAGAGTTT TTGGGTGATGCAGTTTtgggtaaatataaaaagaatataatagttgattt taattctaaatttaatttaaaattttagattatttaattacGCGGCATTT ATATGAAGACAAGCGACAACATTCACCTGGAGCTTTGACAGATCTTCGTT CAGCACTAGTCAATAACACAATTTTTGCATCCCTTGCTGTTAGAAATGGT TTTCATaagtatttcaaacatttatccCCAGGTTTGGCTGAAGTTGTTTG TAGATTTGTAACCATACAAGAAGAGAATGGCCATACTATTGATGAAGagg tacctaactattattcaaacatatatctttatttttattttgctatgcGT ATTTATGGTAAAAGTTgtacttttatgaatttatttaacgtTAAAACTAC ACACATctttaaaacagtatttttagtttaagtattaagactaacatttt aatacaatgttacttatattttattcaatcgaTTTCAAAATTAGTTCATA TAAATACTAGATTTCtacttaaaatcatttttttgtaatcTTCATTGATC AttgatcttaaataataaaatgctggATTAACTTAATTTTGAGTGCTAAT AATGGATTTTCCCACAActcaatgaaatatataaacttttaaaacatttt ttagttttattttttgggaGAAGATGATTGTGAAGAAGCTGAAGACGTTG AAGTGCCAAAAGCCCTTGGTGATGTTTTTGAATCGGTTGCAGGAGCAATT TATTTGGATAGTAATATGTCATTAGATACAGTATGGAaagtttatcataa aataatggaaaatgaAATGGGTaaggttacatattattatgatcacttaa atattatcaatttttttttttaccttaatgcttcaaaaatatgtatttgt ttatgagcaaatttaatgttttagtattttttaaataatttttataagct aTGTTAGTGTAGTTGTAAAAACCAAGTACAGTAGAACTTCGATTAACCGT CACTGTCGGGACCGGGGCTATGACGGTTAATCGAATAGACGGTTAACGga aattttgcaaaaaaaaaaacgtgtacatacatatacacacatttattata ttttttacgtgtgtgtactttaaaaataatacatataaaaaaaatataac atataaattaattattgtaacacATATAAACACGACACATAAACTACGAA AACACTAATACACACGGTACACACTTACACGTAGGCTGTTCGTCGGTCAc tgattaaattacaatacatacatacatagtacaatacatacacacataaa ttTATAGTTCGTTTATCACATTTATCGCTTATATtggatatgtatatatt acaaactatttttatacacttGATAGTTACTGTGTTGGGCACCACGACGA GTTTATCACAATcgtctaattattttttttttcggcgaTGACCGATGACG GATAACAGAGAGTGACGGTAGTTctactgtattattaaatattaaaaata gtttatataatacaaaacaaatacttaaatatttaaaaattgtttctctG AGTGAAgcatcttaattattatattaaaacatttaaaatggctaaaaaaa tagtatgtggTGTCAACACAAGCATTATGCTTAAAGGGGAGTTGAAAACA TGTATTTAAAACacatatgacaattttttttttagtcattaaaCCAACCT ACCTACCCACCAGAACCGcttacaaactaaaaattatattcttcaaAACG ATATAGAACAGTTAatgatctattattttattctatagtccctttttttt aaacattatagctactacctagtacctacccaCCCATTTATTTAGCTATG ACATTTGTCATAGGCAAAACCTACTTTTRGCGTCCCTGAATGGcctgaat attaataaatatgtaccttAAACAAGCCTCAAGTAGTGAAAACTATTAAt taccaataattaatataataattaattactaaatgcttgatatttattat agttaatgtttttaattttataaataaatgcttgaatatatgttatatgt tattatttatgttatagaaCAATTTAGTAAAAACGTACCGAAATCTCCTA TCAGAGAACTTCTAGAATTAGAACCAGAAACTGCAAAATTTAGGTgagta acatttaaaaaataatatcaaaaaattgttatttggtAGGAACATAGTAC TAGTGTAGGTTTGCTACATAGaaagtgcatattatatgtcatttgaatat tttttttcagttacatAATTTAAAGATGATGGAAACATGGGTTAATTYGA TATACTTAGTGCGATTTAACTTATTAGCATGAGAGATTTTgaccatacaa tttttttgtctatgcatacattatttttttaataatattgagtacTTATG AACAATTGTATAGAAGAGGTTTTGAGCATAGGCACAAATAGGGAGGGGGG CTTTAGGAGCTAAGGCCCCTAACTAAACCTttcttaaatgttatattaag cttattaaatattagtaaaattaggTTTTAAACCCCCGGGGGGCCATATC TCAAACACTATTTGCGCATATGGCTTCTgagattttgttatatttagtag aactattttttttatcaactataaagtatattttatYatttatattcaaa attatttacggtatggaataattaattttacttattcccaaatattttat tataacgttaATAGAGTCAAACAACATTTGACCTAAAAACATTTTGGAGA CCGATTATGCTAAATTGTTatgctattaaaaaaagttgttgTTTGTAGTA GAGTACATGCATATAACCTAATAATCAGAAAATGTGTTAATTtcttagta tatttaatattataaaagatggATTTTTTTCTATTRTTTCTAGTAAACCT GAAAAGTTGGCAGATGGTCGACGAGTTCGGGTTGTAGTTGAAATATTTGG CAAAGGAGAATTTAAAGGTATTGGTCGTAATTATAGAATCGCTAAATGTA CAGCGGCCAAATGTGCCTTAAAGCATCTAAAGAAAAAGATAAAGAAATAG ATCATAATCTATGTACTTTACATTATACAGTATTRATTGGAAACAAGTAC ATAAAGCGATATCtgttaaagaataaaatttattttgtagttaataaagt aatacattcaattgttgatt
back to top

Coding sequence (CDS) from alignment at JOTR01000065:692291..707460+

>rna3669 ID=rna3669|Name=XM_015507628.1|organism=Diuraphis noxia|type=CDS|length=5349bp|location=Sequence derived from alignment at JOTR01000065:692291..707460+ (Diuraphis noxia)
TAAACCTGAAAAGTTGGCAGATGGTCGACGAGTTCGGGTTGTAGTTGAAA
TATTTGGCAAAGGAGAATTTAAAGGTATTGGTCGTAATTATAGAATCGCT
AAATGTACAGCGGCCAAATGTGCCTTAAAGCATCTAAAGAAAAAGATAAA
GAAATAGaaCAATTTAGTAAAAACGTACCGAAATCTCCTATCAGAGAACT
TCTAGAATTAGAACCAGAAACTGCAAAATTTAGttttattttttgggaGA
AGATGATTGTGAAGAAGCTGAAGACGTTGAAGTGCCAAAAGCCCTTGGTG
ATGTTTTTGAATCGGTTGCAGGAGCAATTTATTTGGATAGTAATATGTCA
TTAGATACAGTATGGAaagtttatcataaaataatggaaaatgaAATGGa
ttatttaattacGCGGCATTTATATGAAGACAAGCGACAACATTCACCTG
GAGCTTTGACAGATCTTCGTTCAGCACTAGTCAATAACACAATTTTTGCA
TCCCTTGCTGTTAGAAATGGTTTTCATaagtatttcaaacatttatccCC
AGGTTTGGCTGAAGTTGTTTGTAGATTTGTAACCATACAAGAAGAGAATG
GCCATACTATTGATGAAGagGTGCCTATTTGATATCTTGTGGTGCTCGTg
gagcattattatttatgtcttgGCTAGGAATAAAAGTATTACCTACGCTA
CATGATTCAAAATTAGGTTATCTAAAACCCCCATCATCTCCAMTTCTACG
TAATGTTGACGATCCCGAAGGCGAATTAACAAAGTTGATGGATGGATTTG
AATCTTTTGAACAGCATTTAGGATACCATTTTCAAGATCGTAGTTATCTA
TTACAAGCAATGACTCATGCTTCTTATTACCCCAATCGTTTAACTGATTG
TTATCAACGATTAGAGTTTTTGGGTGATGCAGTTTtggatCACATGTGGG
AGCCTTTAGATTTTGGTTGGACCATGAaagatgtattaataaaaagaaaa
gaacAAAAAGAAATTAGTACGATAAAAGTTGCTGAACCAGTTGAAACTGT
TAAGCAACTTGTAGATGAAAAGATAAAAGAAGAAAAGATAGATAAATCAG
ATGATCCTAATTGGATGGAYATTGGAACATGGTCTAATGATATGGCTGAC
TTtgcaatgaataatattgatagtaCGACAAAAGTAAGGTATTCATCACC
TACTAGTTGGATGATTCAAAGTGATAATGAATCAAGCACGTTCAGTGATC
TTGATTCAGATGATGGGATTCAAGTTAATGGTTTACACTCTAATGGTTTA
CGAATAGAATTTAGAAATACTTATTTAGCTGAAGCTGTGGATGAAAATGA
ttccaaaacaaataaattattatttttccaaaacaaTGAAACTCCTCAAT
TGTGGACTTGGAATGACAATGGTCACTCTGTAACTGAATATAATTCTAAT
CAACAAGACAaacaaattatagatttattttataaaaaagatgatgatat
tattataaatcgagAAGTAAAAAGTAGTACCAATATTGACAGCTTATCTT
TATTAAAACTACCATGGGAATTAAATGCAAATACTGGTTATGGACTTTCA
GACATCAATGTTTTATCGGATAAAACTTCATTTATCCCTGAAgatgataa
tgatattaaaagtgaaatattcataaaaaataaaacattcgatAGTGTCA
ATAAAGTTCATGGTGTGCAATCTGAAACATTTAGTTTTGATTTTCAGCCA
GACTTAAACAATCATCCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATT
AACTATGTCAAATGCAAATGATggaattaatttggaacgtttGGAAACTA
TCGgagattcatttttaaaatatgccaTTACAGCTTACTTATACTGTACC
CATGATAATGTTCATGAAGGTAAATTGAGCCATCTTAGATCAAAACAAGT
CAGTAATTTGAATTTGTATCGTCTTggtaaactaaaaatgtttggCGAAC
GTATGATATCTACAAAATTTGAACCTCATGATAATTGGTTACCACCTTGT
TATTTTGTCCCTCATAAATTAGAAAAAGCTCTTATTAGTGCTAGTATACC
AACAACTTTATGGAATATGATAACACTTCCCACATTTAAGGATCCTACAG
ATAAAGAAATTGAAGAAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAAT
GAGGACAAAGAAAATACCCCTTTATTTGTGCCATACAACCTTGTTACTCA
ACATAGTATTCCTGATAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtg
GTATATGAATCGTAAAGGTGTAATTTTACCTACTAGTAGTGATGCAACTA
AAAGAGCTAAACGAGATAATCTAAGTCAAAAACAAATTCTTGTTCCTGAA
CTTTGTAATGTTCATTTATTTCCAGCATCAATGTGGCGTAAAGCTGTTTC
TTTACCATGTATACTATATCGCATTAATGCTTTATTGTTAGCTGATGAAA
TTCGTACTATTGTTGCCAAGGATATATCTTTAGGATTGGTTAACTTAAGT
TTTGTATTTCTATGTAGCAGAGATTTGTACACATCTTAATCCAAAATCAC
CATTTCCTGGTTCTAtagaaaactataaaacatttgAGGATTACTATTAT
CTTAAGTATAgattaaaaatccaaaatctTGAACAACCTCTTTTAGATGT
GGATCATACTTCTGCAAGACTTAATTTTCTTACACCAAGatacaagtGGA
TTGATAGACATTGATTGGAAATTCCTAgataatatgcataaatgtaAAGA
TAATAAACTAAGTATTATAACTAATGAAGATAGAATACATTTTCAACCTG
ATATTGAAGTATTGAAAGATGCTGTTGTTACTCCTTGGTATAGAAATCAA
GAACAACCCCAGATTCCGCCATTTCCCATATATACTCGATGTGGTGAAGT
ATATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACAACATC
AACTGGATAATATagccacatttttaaattatacgttCACCAATGTACTA
CGTTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcataattg
ttattatattgtgccAACTCTTCGAGATTGCTGAGGCATTTAATGACTGT
AGACCAGTTGAAGGTAAAGCTTGTCATTTATATgctatattgttaaatat
gaatTGTCCTGTACCAGAAGAACAAAATACTAGAGGTCGAAGAATTCATC
CACCCGAAGAATCCATTCATGGGTTTGGTATACTTACAATGAAACACATT
CCAAgtggTCATCCAATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGC
ATTAGAAGTGTGTAGACAACTTCATTCTCAAGGTGAATTAGATGACACCC
TTCAACCTATTACAAAAGAATCATTTCATGCATTGTTCAATGCTGACGAA
GTATTGCCAGACGCTGAAGATGCATTAATACCTTGGGACACAGAAGAGCC
TAGACCTGGAACAAATAAACGCCGCCAATACTACTATAaaagagtattgt
gcAAAATTACCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGAT
ACAATCAGTAGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGAC
TTCCAATTAATTCACCTATTAAACATGATATAcatatgTTATTAAATCAT
TGCACTTTAAAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTA
TAATTGGTGTGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCAT
TTGTTGATATGGCAACAGCCATAGGACTTGtgaatagGTTTCGACAAAGA
GAATGTAATGTACTTATTGGAACTAAAGTATTAGAAGCAGGAATTGATTT
ACCTCGATGTAATTtagtgattaattataatataccacttTCATACAAAT
CATATCTAAGGTCTAAAAGTAGAGCAAAAACAWTAGAtgctcattatatt
ttaatgtttgacgAAGATGctacttcaaatattttatctcgTCTTAAACT
ATATAAAGACATTAACCagGATTTGAAAAACAGTAACAAAGAAGATTTTG
GTTGGATTCAACCTCAATACACAGTAGATAAAGAAGCAGATCCAATTACT
GAACCTAAAGAATTTGAAATTGAACATAAAAAGCAAGAAGAAACTTTAAG
AAGatttgcaATTTTATCAAGCCAAATAGTAAATGTAGAATATTGGGTAT
TGTTCATccattatttgaatttgattcTGATCCATTCTTTATTGaaaatc
aattgaaatttatatcacACAAATTGATTTCATCTATCGAGACTGCCAGT
GATATTGTTTCTATATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCAT
TGAATGTGCTATTCACACAGAAGATCTTACCAATATTAAGATAAAGACAA
TGGTGCAGAGTTTAACTGAATTCTTAAATGACCATAATTATGAGCCTGCT
ATCATATATGGAGACGATGAAGAATTTGGTGaagaattaaaacaaatacc
taACCCTAAAAATGAACCTTTACAAATGATAGCTGATTTTTTggagattt
taaaaacaatgggTCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTG
TATATGGTAGAAAAATTGAAAGTTAAAACTCCATATGAAAGACACTATGT
TTTGTTATGTATTGTTTCTACATTATTGATTCAAATAAGAGCCAcatttg
atgatattttttataattatagtaatattgataAAGTACTGAAATTTAGT
TCTCCTCGTGTATTACGAATTATTAATACTCTCAAACAATTTAAACCAAA
ATCTTTTAAAGCAGATAGTAACAATGTTGAAGTATGTAAagatcaaaaag
aaaaaaaagatagaaCTATCAAATCTAAATCAATAAGACGTAATTGGAAA
TTAGCTAGGAGATATGGAACTCATAGAAAACAAGGACGATCAAGAGATCC
GTATGAAGAAACTGTTTGTGCTATAATTCTCGTAAACAACAAAATGACAG
CttctattttgtattatttatttttaGTAATTATTACTACTGAAAACCTA
TGTTtagaattatttgaaaaaaaatatttgcgatTTGACCAGCTTAACTT
AGCTATATTCAATAACTGCCAGAAAATAATTCAGGAAAATAGTACttatt
ataagGAAATCTGAAAAAAGAAAATGGACTTTACTTGTTTTAGAAGAAAC
AGAAATTGATCAGTACATGTTTTCTATTGGACATTTGACAGATTTAAAAC
CATTAGACATCAGATCAGTCAATCATttggattttattaattatgagat
back to top