rna3670 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507630.1
Unique Namerna3670
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:693595..707460 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507630.1
Productendoribonuclease Dcr-1, transcript variant X4
Model evidenceSupporting evidence includes similarity to: 17 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161280
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507630.1
GeneID107161280
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161280gene2480Diuraphis noxiageneJOTR01000065 692291..707460 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507630.1rna3670Diuraphis noxiapolypeptideJOTR01000065 693643..707340 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32094id32094Diuraphis noxiaexonJOTR01000065 693595..693818 +
id32095id32095Diuraphis noxiaexonJOTR01000065 693886..694027 +
id32096id32096Diuraphis noxiaexonJOTR01000065 694100..694228 +
id32097id32097Diuraphis noxiaexonJOTR01000065 695431..696303 +
id32098id32098Diuraphis noxiaexonJOTR01000065 696380..696513 +
id32099id32099Diuraphis noxiaexonJOTR01000065 696605..696836 +
id32100id32100Diuraphis noxiaexonJOTR01000065 696917..697068 +
id32101id32101Diuraphis noxiaexonJOTR01000065 697225..697366 +
id32102id32102Diuraphis noxiaexonJOTR01000065 699986..700222 +
id32103id32103Diuraphis noxiaexonJOTR01000065 700301..700480 +
id32104id32104Diuraphis noxiaexonJOTR01000065 701508..701721 +
id32105id32105Diuraphis noxiaexonJOTR01000065 701783..701955 +
id32106id32106Diuraphis noxiaexonJOTR01000065 702011..702195 +
id32107id32107Diuraphis noxiaexonJOTR01000065 702251..702504 +
id32108id32108Diuraphis noxiaexonJOTR01000065 702564..703925 +
id32109id32109Diuraphis noxiaexonJOTR01000065 703992..704309 +
id32110id32110Diuraphis noxiaexonJOTR01000065 704369..704589 +
id32111id32111Diuraphis noxiaexonJOTR01000065 704945..705110 +
id32112id32112Diuraphis noxiaexonJOTR01000065 706358..706433 +
id32113id32113Diuraphis noxiaexonJOTR01000065 707184..707460 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363116.1cds3573Diuraphis noxiaCDSJOTR01000065 707184..707340 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3670 ID=rna3670|Name=XM_015507630.1|organism=Diuraphis noxia|type=mRNA|length=5691bp|location=Sequence derived from alignment at JOTR01000065:693595..707460+ (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
ttcaatTAGGAAGTTCTGTCTATCAggattaattttcaatttaatttaat
ggcGTTAACATTCGgtgataatatacatactagAACATTTACTCCTCAAG
AGTACTTAGTTGAAATTCTAAGTTcagctaaaaacaaaaatataattatt
tcattagaaGGTACAACAAATAaggtatttgttattttaaaactcaTTCG
AGAACTtgcttttaaaatttacagGAAATCTGAAAAAAGAAAATGGACTT
TACTTGTTTTAGAAGAAACAGAAATTGATCAGTACATGTTTTCTATTGGA
CATTTGACAGATTTAAAACCATTAGACATCAGATCAGTCAATCATttgga
ttttattaattatgagGTAATTATTACTACTGAAAACCTATGTTtagaat
tatttgaaaaaaaatatttgcgatTTGACCAGCTTAACTTAGCTATATTC
AATAACTGCCAGAAAATAATTCAGGAAAATAGTACttattataagatttg
caATTTTATCAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTTCATc
cattatttgaatttgattcTGATCCATTCTTTATTGaaaatcaattgaaa
tttatatcacACAAATTGATTTCATCTATCGAGACTGCCAGTGATATTGT
TTCTATATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAATGTG
CTATTCACACAGAAGATCTTACCAATATTAAGATAAAGACAATGGTGCAG
AGTTTAACTGAATTCTTAAATGACCATAATTATGAGCCTGCTATCATATA
TGGAGACGATGAAGAATTTGGTGaagaattaaaacaaatacctaACCCTA
AAAATGAACCTTTACAAATGATAGCTGATTTTTTggagattttaaaaaca
atgggTCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATATGGT
AGAAAAATTGAAAGTTAAAACTCCATATGAAAGACACTATGTTTTGTTAT
GTATTGTTTCTACATTATTGATTCAAATAAGAGCCAcatttgatgatatt
ttttataattatagtaatattgataAAGTACTGAAATTTAGTTCTCCTCG
TGTATTACGAATTATTAATACTCTCAAACAATTTAAACCAAAATCTTTTA
AAGCAGATAGTAACAATGTTGAAGTATGTAAagatcaaaaagaaaaaaaa
gatagaaCTATCAAATCTAAATCAATAAGACGTAATTGGAAATTAGCTAG
GAGATATGGAACTCATAGAAAACAAGGACGATCAAGAGATCCGTATGAAG
AAACTGTTTGTGCTATAATTCTCGTAAACAACAAAATGACAGCttctatt
ttgtattatttatttttaGATTTGAAAAACAGTAACAAAGAAGATTTTGG
TTGGATTCAACCTCAATACACAGTAGATAAAGAAGCAGATCCAATTACTG
AACCTAAAGAATTTGAAATTGAACATAAAAAGCAAGAAGAAACTTTAAGA
AGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAACTAAAGTATTAGA
AGCAGGAATTGATTTACCTCGATGTAATTtagtgattaattataatatac
cacttTCATACAAATCATATCTAAGGTCTAAAAGTAGAGCAAAAACAWTA
GAtgctcattatattttaatgtttgacgAAGATGctacttcaaatatttt
atctcgTCTTAAACTATATAAAGACATTAACCagatgTTATTAAATCATT
GCACTTTAAAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTAT
AATTGGTGTGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCATT
TGTTGATATGGCAACAGCCATAGGACTTGtgaataggtattgtgcAAAAT
TACCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACAATCA
GTAGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTCCAAT
TAATTCACCTATTAAACATGATATAcatggTCATCCAATGCCATGTGAAA
TTTTAGCAAAAAGAATAGCTGCATTAGAAGTGTGTAGACAACTTCATTCT
CAAGGTGAATTAGATGACACCCTTCAACCTATTACAAAAGAATCATTTCA
TGCATTGTTCAATGCTGACGAAGTATTGCCAGACGCTGAAGATGCATTAA
TACCTTGGGACACAGAAGAGCCTAGACCTGGAACAAATAAACGCCGCCAA
TACTACTATAaaagaATTGCTGAGGCATTTAATGACTGTAGACCAGTTGA
AGGTAAAGCTTGTCATTTATATgctatattgttaaatatgaatTGTCCTG
TACCAGAAGAACAAAATACTAGAGGTCGAAGAATTCATCCACCCGAAGAA
TCCATTCATGGGTTTGGTATACTTACAATGAAACACATTCCAAgtATTCC
GCCATTTCCCATATATACTCGATGTGGTGAAGTATATGTGAGTTTAAAGC
CTATAAAAACAGATATGTTTCTAACACAACATCAACTGGATAATATagcc
acatttttaaattatacgttCACCAATGTACTACGTTTGCAAAAATGTCA
TGTGGCATTTGATCCAACTACTActcataattgttattatattgtgccAA
CTCTTCGAGatacaagtGGATTGATAGACATTGATTGGAAATTCCTAgat
aatatgcataaatgtaAAGATAATAAACTAAGTATTATAACTAATGAAGA
TAGAATACATTTTCAACCTGATATTGAAGTATTGAAAGATGCTGTTGTTA
CTCCTTGGTATAGAAATCAAGAACAACCCCAGTATTTCTATGTAGCAGAG
ATTTGTACACATCTTAATCCAAAATCACCATTTCCTGGTTCTAtagaaaa
ctataaaacatttgAGGATTACTATTATCTTAAGTATAgattaaaaatcc
aaaatctTGAACAACCTCTTTTAGATGTGGATCATACTTCTGCAAGACTT
AATTTTCTTACACCAAGGTATATGAATCGTAAAGGTGTAATTTTACCTAC
TAGTAGTGATGCAACTAAAAGAGCTAAACGAGATAATCTAAGTCAAAAAC
AAATTCTTGTTCCTGAACTTTGTAATGTTCATTTATTTCCAGCATCAATG
TGGCGTAAAGCTGTTTCTTTACCATGTATACTATATCGCATTAATGCTTT
ATTGTTAGCTGATGAAATTCGTACTATTGTTGCCAAGGATATATCTTTAG
GATTGGTTAACTTAAGTTTTGatCACATGTGGGAGCCTTTAGATTTTGGT
TGGACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAATTAG
TACGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTAGATG
AAAAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTGGATG
GAYATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaataatat
tgatagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATGATTC
AAAGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGATGGG
ATTCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTAGAAA
TACTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaataaat
tattatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAATGAC
AATGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaacaaat
tatagatttattttataaaaaagatgatgatattattataaatcgagAAG
TAAAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACCATGG
GAATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTTTATC
GGATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagtgaaa
tattcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGGTGTG
CAATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATCATCC
TGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAATGCAA
ATGATggaattaatttggaacgtttGGAAACTATCGgagattcattttta
aaatatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTCATGA
AGGTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAATTTGT
ATCGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTACAAAA
TTTGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTCATAA
ATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGGAATA
TGATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGAAGAA
GTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAAATAC
CCCTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCTGATA
AAAGTATTGCTGATTGCGTAGAAGCTTTAATtgGTGCCTATTTGATATCT
TGTGGTGCTCGTggagcattattatttatgtcttgGCTAGGAATAAAAGT
ATTACCTACGCTACATGATTCAAAATTAGGTTATCTAAAACCCCCATCAT
CTCCAMTTCTACGTAATGTTGACGATCCCGAAGGCGAATTAACAAAGTTG
ATGGATGGATTTGAATCTTTTGAACAGCATTTAGGATACCATTTTCAAGA
TCGTAGTTATCTATTACAAGCAATGACTCATGCTTCTTATTACCCCAATC
GTTTAACTGATTGTTATCAACGATTAGAGTTTTTGGGTGATGCAGTTTtg
gattatttaattacGCGGCATTTATATGAAGACAAGCGACAACATTCACC
TGGAGCTTTGACAGATCTTCGTTCAGCACTAGTCAATAACACAATTTTTG
CATCCCTTGCTGTTAGAAATGGTTTTCATaagtatttcaaacatttatcc
CCAGGTTTGGCTGAAGTTGTTTGTAGATTTGTAACCATACAAGAAGAGAA
TGGCCATACTATTGATGAAGagttttattttttgggaGAAGATGATTGTG
AAGAAGCTGAAGACGTTGAAGTGCCAAAAGCCCTTGGTGATGTTTTTGAA
TCGGTTGCAGGAGCAATTTATTTGGATAGTAATATGTCATTAGATACAGT
ATGGAaagtttatcataaaataatggaaaatgaAATGGaaCAATTTAGTA
AAAACGTACCGAAATCTCCTATCAGAGAACTTCTAGAATTAGAACCAGAA
ACTGCAAAATTTAGTAAACCTGAAAAGTTGGCAGATGGTCGACGAGTTCG
GGTTGTAGTTGAAATATTTGGCAAAGGAGAATTTAAAGGTATTGGTCGTA
ATTATAGAATCGCTAAATGTACAGCGGCCAAATGTGCCTTAAAGCATCTA
AAGAAAAAGATAAAGAAATAGATCATAATCTATGTACTTTACATTATACA
GTATTRATTGGAAACAAGTACATAAAGCGATATCtgttaaagaataaaat
ttattttgtagttaataaagtaatacattcaattgttgatt
back to top

protein sequence of XM_015507630.1

>rna3670 ID=rna3670|Name=XM_015507630.1|organism=Diuraphis noxia|type=polypeptide|length=1841bp
MALTFGDNIHTRTFTPQEYLVEILSSAKNKNIIISLEGTTNKVFVILKLI
RELAFKIYRKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHL
DFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKI
CNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDI
VSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAII
YGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYM
VEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSP
RVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLA
RRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDF
GWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVL
EAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNI
LSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSP
FVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLP
INSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESF
HALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPV
EGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSI
PPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKC
HVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNE
DRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIE
NYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILP
TSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINA
LLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEI
STIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNN
IDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFR
NTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQ
IIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVL
SDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNH
PGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVH
EGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPH
KLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKEN
TPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIK
VLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQ
DRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHS
PGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEE
NGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDT
VWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRV
RVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK.
back to top

mRNA from alignment at JOTR01000065:693595..707460+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3670 ID=rna3670|Name=XM_015507630.1|organism=Diuraphis noxia|type=mRNA|length=13866bp|location=Sequence derived from alignment at JOTR01000065:693595..707460+ (Diuraphis noxia)
ttcaatTAGGAAGTTCTGTCTATCAggattaattttcaatttaatttaat ggcGTTAACATTCGgtgataatatacatactagAACATTTACTCCTCAAG AGTACTTAGTTGAAATTCTAAGTTcagctaaaaacaaaaatataattatt tcattagaaGGTACAACAAATAaggtatttgttattttaaaactcaTTCG AGAACTtgcttttaaaatttacaggttagtcataaaaattaaatattaat attaacaatgatcaaatgataaataaattgattttctatAGGAAATCTGA AAAAAGAAAATGGACTTTACTTGTTTTAGAAGAAACAGAAATTGATCAGT ACATGTTTTCTATTGGACATTTGACAGATTTAAAACCATTAGACATCAGA TCAGTCAATCATttggattttattaattatgaggtttgtattaaatatta taatctttttttcctcctaaaaaatgttttaaatattttgattttggtcT TCCAGGTAATTATTACTACTGAAAACCTATGTTtagaattatttgaaaaa aaatatttgcgatTTGACCAGCTTAACTTAGCTATATTCAATAACTGCCA GAAAATAATTCAGGAAAATAGTACttattataaggtatttaaattttttc taatcagattaattattttgattaaagtaAAAACTCTATAAAACAGACAT CAGTAACAGACTTTTATCACTAAGAGATGTAAGTGCTGCATGTAGTAATG TAGTATGCATATATCGGGTGATTAATTTAATgcaagatattaattttttg aaagtattaatgtttttgaaaatattcttttcaTGATTTCTAATCCTTTA AAACTAtacttttttctaaaataaatattaaaaaaattaattgttatcat agtttgaattttgtctttaaaaacagaatatttttttaaggtacttttat acataaaaatcaaatttaggatgagtatttatgagttataacttctAGAC CAAAGCCTGTGAAACAGtggttcttaattttttttagttcatggcacact attatacattacaagTTTGCACAGCACACTCACCAACAAAAATGTAAgga aataaattactgttttcaatattttttatcagcataaatacaaaaatcag ACATTTCTCGCGTCACAGCGGTTTTGGGAACCACTCCAGTAAAAtattga tcaatttttttttttggggggggggatcaAGGTCTGGACCTTAAACCTTC CTGGCTAGTTATAAAAAAGTATCAAAAGTTTGATGTGTGGAGCAGTAAAT CAATATTTGGTGAGATAACCTCATACCATtccacttatttaaaattttaa atacttaaaagtcaaaaactactcattctaaatttaatttttatgtattg aaatacgagtatttagaaaaatattctgttggaatatgaaattaaaactg aatattGTCTTTCAAAAagataaaaatcttaaaaatgtttggcataaaaa atattttgtattttttagtgGCTAGAAaccatgaacatttttttttaaac atctatacattttgaaataatgagtgttcagtgattaaaaaaatcatccg ATATTCAGCATTAGgcatagatataattttatttaatatgtattgatGAA ATTTAGGAAATATCTAATCGGAATtcgcatattattttgatagttaTTCT CAAGGTGGCTATAGCCAATAATGAATAAACCCCTGTTCTGTAGGTAGGCC TTGGCAAACAGATGTCTTCAAATAGAGGTTTtactttatagtaaaataat acgaAAGTAATGTTgaaattctttttatttttttagatttgcaATTTTAT CAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTTCATccattatttg aatttgattcTGATCCATTCTTTATTGaaaatcaattgaaatttatatca cACAAATTGATTTCATCTATCGAGACTGCCAGTGATATTGTTTCTATATT GCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAATGTGCTATTCACA CAGAAGATCTTACCAATATTAAGATAAAGACAATGGTGCAGAGTTTAACT GAATTCTTAAATGACCATAATTATGAGCCTGCTATCATATATGGAGACGA TGAAGAATTTGGTGaagaattaaaacaaatacctaACCCTAAAAATGAAC CTTTACAAATGATAGCTGATTTTTTggagattttaaaaacaatgggTCCA TATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATATGGTAGAAAAATT GAAAGTTAAAACTCCATATGAAAGACACTATGTTTTGTTATGTATTGTTT CTACATTATTGATTCAAATAAGAGCCAcatttgatgatattttttataat tatagtaatattgataAAGTACTGAAATTTAGTTCTCCTCGTGTATTACG AATTATTAATACTCTCAAACAATTTAAACCAAAATCTTTTAAAGCAGATA GTAACAATGTTGAAGTATGTAAagatcaaaaagaaaaaaaagatagaaCT ATCAAATCTAAATCAATAAGACGTAATTGGAAATTAGCTAGGAGATATGG AACTCATAGAAAACAAGGACGATCAAGAGATCCGTATGAAGAAACTGTTT GTGCTATAATTCTCGTAAACAACAAAATGACAGCttctattttgtattat ttatttttagtaagcatattttattttttatcagttaaattaatttaaaa tgaagtaattattttattgtttttatcttcTTTAGGATTTGAAAAACAGT AACAAAGAAGATTTTGGTTGGATTCAACCTCAATACACAGTAGATAAAGA AGCAGATCCAATTACTGAACCTAAAGAATTTGAAATTGAACATAAAAAGC AAGAAGAAACTTTAAGAAGGTttgattgtatacattttttataaaagatt attttcaataaactgTATTTGattgcaattaataatttagtataaaaatg gtTATTTCAGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAACTAAA GTATTAGAAGCAGGAATTGATTTACCTCGATGTAATTtagtgattaatta taatataccacttTCATACAAATCATATCTAAGGTCTAAAAGTAGAGCAA AAACAWTAGAtgctcattatattttaatgtttgacgAAGATGctacttca aatattttatctcgTCTTAAACTATATAAAGACATTAACCaggtaaaaat tgattttaaataaataaattatttatctaaccaatacataatttaaaatg gttttaaattatttttttctagatgTTATTAAATCATTGCACTTTAAAAG ATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTATAATTGGTGTGTT ACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCATTTGTTGATATGGC AACAGCCATAGGACTTGtgaataggtattaatttatattattagttcatc atacatttttcataatattttatttgtgtttataacttataagtactaTT TTTATCTGACTGATTAATtcctatgttattataatgattgcattatattt cctaaaatatttataaatgtgttaatataggtattgtgcAAAATTACCTA GTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACAATCAGTAGTG TATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTCCAATTAATTC ACCTATTAAACATGATATAcatgtaagtattatttatgcattatagAGAA CTAGATTGTCATATTAACTAACTAAGAAACTCTAAATAGCTTATTGAACA TAGTGGTGCTATGATGGACTTAAAGTGAAACCTCACACCTACTGGGTACT TAGGTGTGTAGcacatattcaatataataatatttttctcttttaaaaca attttaaatactattgatataaaaaaatgtgaagaaGCAGGTAACACTGT GCTGTACATAGGTATCATGCGGATCACTGGATGTGTTAAATgtgatttca attttataaaattatcttatataaaatgCGGTTCTGAGTAAAGTCAATCT GttagcctatattataataactaaaaccaCTATTCTCAGTTTAAGAAGCC AATTTCATGTAAATTTTAACTTAGAATatctattgaaaaatattgtgttt atttaattttttgatttttttttctctattcaTATCGACCTATAAGTTTT TTGCAAAAATGTTTGAAAGGCTTATTCTTAAAAGAATTCTGCCATACATT TCTTCAAGTAACATACTTCCAAATACTCAATTTGGCTTTCTTGTCTCTCA TTCCACAACTCATCAACTACATAGATTAGTCGATACCATTTCGTTCTCac ttgaaaagaaaaaatactgCTCGTGCGTGTTCCTTGATGTCTCTCAAGCC TTTGATAGGGTTTGGCATGAAGGGCTGTTATATAAACTAAAAGCTTTTCT TCCcccaacatattttttactcattaaaTCTTATTTTGCGGAACGTCACT TTTAAGTCAAGTTTGGCTCTTccttttcaaaaattgaaaaaattagtgCA GGAGTCCCTCAAGGTGGCATTGTTCAccaatactatataatgtatatgca aCAGACCAACCTACCTCTCCATCAACATCTGTAGCTGAATTTACGGATGA TAAGGCAATTATATCAGTACACGAAGACCCACACATTGTTTCTCTAAatc agcgtttcttaaacttttttatccgtgAAACACTTTTTAATGTCCACTTT TATCGTGGAACCCCTACTTCTTTTtagctttttagtttttttttaggatt atttgcaaataaattataatattaagtagaagtatagattattgaatata ttgagTTATCTGATAGATTATTCCATAtggcttatacattattatttaat atacaagtattattttccataatggatattttaaagtaattttcttgaac atttaaaaaaaattacttaagcttTGCGGAACCCTGAAGTGATCTACGTG GAACCCCAAGGTTCCGCGgaacacagtttaagaaacgctgctTTAAATCT TCAAAACCACCTTGACCTAATGTCTGTCTGGTATGAAAAATTGTGAGTTC AAGTCAACCAATCAAAATCCATTCACAGTACGTTCACTCTTCGTCTCCCT TAGTAACATACCAATCCCTTCATCCCATTCGGTTAGGTACTTAGGGCTAA CCTTTGACCGTCGCCTCACCTGGGGACTTCATATCAGAACTAAAAAACTA GCTCTAAACGAACGACTTCGCTCAATTAAAACACTAATATCTAACAAGCA TACTAAACACCAAACTTCtcatatataaatcattaattaaggCCTTGTGG ACTTATGGCCWACAACTATGGGacaatgcaaaaaaaaactaatgtaaata aaatccaaaccgttcaaaataaaatcttaagaTTAATCACTAACGCCCCT CCTTATGTCTCCAACTACACTCTGCACACagatttaaatactaaaacagT TCACGATGAAGCAATAACATATTGCAAAAGATTCCATAACAGACTTCCAT ATCATCCTAATCACCTTATATCCAATTTAGCTTCTCGCACAATTCCAGGC AATCCCACCCAACGACTGAAAAGAAAATGGTGTCgagatttacaatttaa ataaataaattaaaattatataaaataaaaagttattaataaacaaataa gtagTGCTTTCACTGGATGGCTTCTTTCCTCACgttttcatgttaaaaaa aatattatatctcacATTTTTATTGTGCTCAAGGCTACAGATTGTATAtt ctttgttaaaaaaaaaaaaagatttttgacTTCTACTTATGTGGaacatt gttttcatttttaagagGGCGCAACAACTGTATTTGTTGTGTCAGTCGTA ACAAGgcgtaacataataaatttatgctcAGCACTTCACGATTTATTCCG TTAGCTTAGAAGTTAGAGTGAATAGGCCTTTTAAAAGCGTAACGTAAAAC ACAGMtaatgtttttaccatcaagtttcataattggtctattcactctaa tttttaagctaacgaaataaaatgtgaactgctgagcataaatttgttat gttacgcgtttgtaagattGAGACAACAATACGGGTGTTGCACCCTCTTA ATTCTTGGTTATAAAACtgaacatcaaaataatttgcaaaatttTTGTGA TTCTGATGAATTTTGTTACTAATAACatttggtaattattaattaagatt gATTTAAGCCATTATTCTCATTCCCAATTGatgtaaaataaactattata gtattatttgattaaatattaatttttaattttttttacagggTCATCCA ATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGTGTAG ACAACTTCATTCTCAAGGTGAATTAGATGACACCCTTCAACCTATTACAA AAGAATCATTTCATGCATTGTTCAATGCTGACGAAGTATTGCCAGACGCT GAAGATGCATTAATACCTTGGGACACAGAAGAGCCTAGACCTGGAACAAA TAAACGCCGCCAATACTACTATAaaagagtataaataatattttaaacat ctaaTATTGAATTGTGTTTTAAAGTAATTTcctaacaattataaaatttt tactagATTGCTGAGGCATTTAATGACTGTAGACCAGTTGAAGGTAAAGC TTGTCATTTATATgctatattgttaaatatgaatTGTCCTGTACCAGAAG AACAAAATACTAGAGGTCGAAGAATTCATCCACCCGAAGAATCCATTCAT GGGTTTGGTATACTTACAATGAAACACATTCCAAgtgtaagtaaatattt ataaatgaaaatataatatgtatttatatgtatacttatacaataagTTC TCGTTTAACTTCTTAGTTAGTTTAGGTtcctaaaaaacaaaacattatgt gaaataaaatgataaatgaaatattgtttcatttttgtaatgggtgattt ACTTAATGATTACTTAAAAAACactgaaaaaatgttttgtctatgttgag cATGGACCAGAGAGAAAAAACAAATGACTGTGCTTTGACATCCTCTTAAA CAACTTATTACCAAAAAAATGAAGAATcaatacgaaatattatgtacata tagtataattacaGCCCTCAGAAACACAATGCCAGTCGAGATGATACCTA GTGTTAGTCTTGAAGGAAATACACCTGGATGGTACGTTGCTACACTGTAT AAACTTATTGATTTAAGATAGATATTGggcatagtatattaaattcagGT ACAATGTGCATAAACTGGTGCATAGAGACCAACACTGAGGTCCAGAAAAg tctaacttaacctaacctttgGAATATGTAAGATGacttttaatcaatat tttaatttttaagtgagataatatgagcattttaaataatatttctcaaa CCCATTTCttgctttaatattaaaacattgaaaattctACTGTATACTGT ACTCTATAWGCTCTTACCTAAATGTTTGATACTAGATTAATTCACTctta tatcaaatatcaaaactaacagcacactattgaaactagtAAGCCACATT TGTTatattgtacgtttgtaagacgtaTACAACAAGTGCATAGGTAGTGT CCTTTTAAGAGTGTATGCACTACACACAATTAAATAACATACAGTCCAAT ATAATAGAAACATTATACTGGAACTATTATACTGTTAAATGGAACACaag gtattaaaattgtatgacttGATAGAAAAGCAATGTTAAACAAGGactta ctgtatatattatattggttataactttataagttataacttggAAATCA AATAACTTTTTAGATTCCGCCATTTCCCATATATACTCGATGTGGTGAAG TATATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACAACAT CAACTGGATAATATagccacatttttaaattatacgttCACCAATGTACT ACGTTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcataatt gttattatattgtgccAACTCTTCGAGGTTGTATGCATCAAATTATTGAT GGTTATAAAAGCTATAAAATGtgattgatatattatagatacaagtGGAT TGATAGACATTGATTGGAAATTCCTAgataatatgcataaatgtaAAGAT AATAAACTAAGTATTATAACTAATGAAGATAGAATACATTTTCAACCTGA TATTGAAGTATTGAAAGATGCTGTTGTTACTCCTTGGTATAGAAATCAAG AACAACCCCAGgtattttctaaacaatttgaatatttataataattaatc ttatttttcTGTTTAGTATTTCTATGTAGCAGAGATTTGTACACATCTTA ATCCAAAATCACCATTTCCTGGTTCTAtagaaaactataaaacatttgAG GATTACTATTATCTTAAGTATAgattaaaaatccaaaatctTGAACAACC TCTTTTAGATGTGGATCATACTTCTGCAAGACTTAATTTTCTTACACCAA GGTTTGCtagtatacataaattataaaaWttttttttatattttaattgt ttgcaGGTATATGAATCGTAAAGGTGTAATTTTACCTACTAGTAGTGATG CAACTAAAAGAGCTAAACGAGATAATCTAAGTCAAAAACAAATTCTTGTT CCTGAACTTTGTAATGTTCATTTATTTCCAGCATCAATGTGGCGTAAAGC TGTTTCTTTACCATGTATACTATATCGCATTAATGCTTTATTGTTAGCTG ATGAAATTCGTACTATTGTTGCCAAGGATATATCTTTAGGATTGGTTAAC TTAAGTTTTGGTAAAGACCATAAACTTACTAAATATTTTctgtatactaa ttatttttacatttaatagatCACATGTGGGAGCCTTTAGATTTTGGTTG GACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAATTAGTA CGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTAGATGAA AAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTGGATGGA YATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaataatattg atagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATGATTCAA AGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGATGGGAT TCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTAGAAATA CTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaataaatta ttatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAATGACAA TGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaacaaatta tagatttattttataaaaaagatgatgatattattataaatcgagAAGTA AAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACCATGGGA ATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTTTATCGG ATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagtgaaata ttcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGGTGTGCA ATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATCATCCTG GGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAATGCAAAT GATggaattaatttggaacgtttGGAAACTATCGgagattcatttttaaa atatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTCATGAAG GTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAATTTGTAT CGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTACAAAATT TGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTCATAAAT TAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGGAATATG ATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGAAGAAGT TATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAAATACCC CTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCTGATAAA AGTATTGCTGATTGCGTAGAAGCTTTAATtggtatagtaaatataattat ttatcagtatAACCATCAAATTTTTCCTAAAATGTTTCCTTTTCTAGGTG CCTATTTGATATCTTGTGGTGCTCGTggagcattattatttatgtcttgG CTAGGAATAAAAGTATTACCTACGCTACATGATTCAAAATTAGGTTATCT AAAACCCCCATCATCTCCAMTTCTACGTAATGTTGACGATCCCGAAGGCG AATTAACAAAGTTGATGGATGGATTTGAATCTTTTGAACAGCATTTAGGA TACCATTTTCAAGATCGTAGTTATCTATTACAAGCAATGACTCATGCTTC TTATTACCCCAATCGTTTAACTGATTGTTATCAACGATTAGAGTTTTTGG GTGATGCAGTTTtgggtaaatataaaaagaatataatagttgattttaat tctaaatttaatttaaaattttagattatttaattacGCGGCATTTATAT GAAGACAAGCGACAACATTCACCTGGAGCTTTGACAGATCTTCGTTCAGC ACTAGTCAATAACACAATTTTTGCATCCCTTGCTGTTAGAAATGGTTTTC ATaagtatttcaaacatttatccCCAGGTTTGGCTGAAGTTGTTTGTAGA TTTGTAACCATACAAGAAGAGAATGGCCATACTATTGATGAAGaggtacc taactattattcaaacatatatctttatttttattttgctatgcGTATTT ATGGTAAAAGTTgtacttttatgaatttatttaacgtTAAAACTACACAC ATctttaaaacagtatttttagtttaagtattaagactaacattttaata caatgttacttatattttattcaatcgaTTTCAAAATTAGTTCATATAAA TACTAGATTTCtacttaaaatcatttttttgtaatcTTCATTGATCAttg atcttaaataataaaatgctggATTAACTTAATTTTGAGTGCTAATAATG GATTTTCCCACAActcaatgaaatatataaacttttaaaacattttttag ttttattttttgggaGAAGATGATTGTGAAGAAGCTGAAGACGTTGAAGT GCCAAAAGCCCTTGGTGATGTTTTTGAATCGGTTGCAGGAGCAATTTATT TGGATAGTAATATGTCATTAGATACAGTATGGAaagtttatcataaaata atggaaaatgaAATGGGTaaggttacatattattatgatcacttaaatat tatcaatttttttttttaccttaatgcttcaaaaatatgtatttgtttat gagcaaatttaatgttttagtattttttaaataatttttataagctaTGT TAGTGTAGTTGTAAAAACCAAGTACAGTAGAACTTCGATTAACCGTCACT GTCGGGACCGGGGCTATGACGGTTAATCGAATAGACGGTTAACGgaaatt ttgcaaaaaaaaaaacgtgtacatacatatacacacatttattatatttt ttacgtgtgtgtactttaaaaataatacatataaaaaaaatataacatat aaattaattattgtaacacATATAAACACGACACATAAACTACGAAAACA CTAATACACACGGTACACACTTACACGTAGGCTGTTCGTCGGTCActgat taaattacaatacatacatacatagtacaatacatacacacataaattTA TAGTTCGTTTATCACATTTATCGCTTATATtggatatgtatatattacaa actatttttatacacttGATAGTTACTGTGTTGGGCACCACGACGAGTTT ATCACAATcgtctaattattttttttttcggcgaTGACCGATGACGGATA ACAGAGAGTGACGGTAGTTctactgtattattaaatattaaaaatagttt atataatacaaaacaaatacttaaatatttaaaaattgtttctctGAGTG AAgcatcttaattattatattaaaacatttaaaatggctaaaaaaatagt atgtggTGTCAACACAAGCATTATGCTTAAAGGGGAGTTGAAAACATGTA TTTAAAACacatatgacaattttttttttagtcattaaaCCAACCTACCT ACCCACCAGAACCGcttacaaactaaaaattatattcttcaaAACGATAT AGAACAGTTAatgatctattattttattctatagtcccttttttttaaac attatagctactacctagtacctacccaCCCATTTATTTAGCTATGACAT TTGTCATAGGCAAAACCTACTTTTRGCGTCCCTGAATGGcctgaatatta ataaatatgtaccttAAACAAGCCTCAAGTAGTGAAAACTATTAAttacc aataattaatataataattaattactaaatgcttgatatttattatagtt aatgtttttaattttataaataaatgcttgaatatatgttatatgttatt atttatgttatagaaCAATTTAGTAAAAACGTACCGAAATCTCCTATCAG AGAACTTCTAGAATTAGAACCAGAAACTGCAAAATTTAGGTgagtaacat ttaaaaaataatatcaaaaaattgttatttggtAGGAACATAGTACTAGT GTAGGTTTGCTACATAGaaagtgcatattatatgtcatttgaatattttt tttcagttacatAATTTAAAGATGATGGAAACATGGGTTAATTYGATATA CTTAGTGCGATTTAACTTATTAGCATGAGAGATTTTgaccatacaatttt tttgtctatgcatacattatttttttaataatattgagtacTTATGAACA ATTGTATAGAAGAGGTTTTGAGCATAGGCACAAATAGGGAGGGGGGCTTT AGGAGCTAAGGCCCCTAACTAAACCTttcttaaatgttatattaagctta ttaaatattagtaaaattaggTTTTAAACCCCCGGGGGGCCATATCTCAA ACACTATTTGCGCATATGGCTTCTgagattttgttatatttagtagaact attttttttatcaactataaagtatattttatYatttatattcaaaatta tttacggtatggaataattaattttacttattcccaaatattttattata acgttaATAGAGTCAAACAACATTTGACCTAAAAACATTTTGGAGACCGA TTATGCTAAATTGTTatgctattaaaaaaagttgttgTTTGTAGTAGAGT ACATGCATATAACCTAATAATCAGAAAATGTGTTAATTtcttagtatatt taatattataaaagatggATTTTTTTCTATTRTTTCTAGTAAACCTGAAA AGTTGGCAGATGGTCGACGAGTTCGGGTTGTAGTTGAAATATTTGGCAAA GGAGAATTTAAAGGTATTGGTCGTAATTATAGAATCGCTAAATGTACAGC GGCCAAATGTGCCTTAAAGCATCTAAAGAAAAAGATAAAGAAATAGATCA TAATCTATGTACTTTACATTATACAGTATTRATTGGAAACAAGTACATAA AGCGATATCtgttaaagaataaaatttattttgtagttaataaagtaata cattcaattgttgatt
back to top

Coding sequence (CDS) from alignment at JOTR01000065:693595..707460+

>rna3670 ID=rna3670|Name=XM_015507630.1|organism=Diuraphis noxia|type=CDS|length=5523bp|location=Sequence derived from alignment at JOTR01000065:693595..707460+ (Diuraphis noxia)
atggcGTTAACATTCGgtgataatatacatactagAACATTTACTCCTCA
AGAGTACTTAGTTGAAATTCTAAGTTcagctaaaaacaaaaatataatta
tttcattagaaGGTACAACAAATAaggtatttgttattttaaaactcaTT
CGAGAACTtgcttttaaaatttacagGAAATCTGAAAAAAGAAAATGGAC
TTTACTTGTTTTAGAAGAAACAGAAATTGATCAGTACATGTTTTCTATTG
GACATTTGACAGATTTAAAACCATTAGACATCAGATCAGTCAATCATttg
gattttattaattatgagGTAATTATTACTACTGAAAACCTATGTTtaga
attatttgaaaaaaaatatttgcgatTTGACCAGCTTAACTTAGCTATAT
TCAATAACTGCCAGAAAATAATTCAGGAAAATAGTACttattataagatt
tgcaATTTTATCAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTTCA
TccattatttgaatttgattcTGATCCATTCTTTATTGaaaatcaattga
aatttatatcacACAAATTGATTTCATCTATCGAGACTGCCAGTGATATT
GTTTCTATATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAATG
TGCTATTCACACAGAAGATCTTACCAATATTAAGATAAAGACAATGGTGC
AGAGTTTAACTGAATTCTTAAATGACCATAATTATGAGCCTGCTATCATA
TATGGAGACGATGAAGAATTTGGTGaagaattaaaacaaatacctaACCC
TAAAAATGAACCTTTACAAATGATAGCTGATTTTTTggagattttaaaaa
caatgggTCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATATG
GTAGAAAAATTGAAAGTTAAAACTCCATATGAAAGACACTATGTTTTGTT
ATGTATTGTTTCTACATTATTGATTCAAATAAGAGCCAcatttgatgata
ttttttataattatagtaatattgataAAGTACTGAAATTTAGTTCTCCT
CGTGTATTACGAATTATTAATACTCTCAAACAATTTAAACCAAAATCTTT
TAAAGCAGATAGTAACAATGTTGAAGTATGTAAagatcaaaaagaaaaaa
aagatagaaCTATCAAATCTAAATCAATAAGACGTAATTGGAAATTAGCT
AGGAGATATGGAACTCATAGAAAACAAGGACGATCAAGAGATCCGTATGA
AGAAACTGTTTGTGCTATAATTCTCGTAAACAACAAAATGACAGCttcta
ttttgtattatttatttttaGATTTGAAAAACAGTAACAAAGAAGATTTT
GGTTGGATTCAACCTCAATACACAGTAGATAAAGAAGCAGATCCAATTAC
TGAACCTAAAGAATTTGAAATTGAACATAAAAAGCAAGAAGAAACTTTAA
GAAGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAACTAAAGTATTA
GAAGCAGGAATTGATTTACCTCGATGTAATTtagtgattaattataatat
accacttTCATACAAATCATATCTAAGGTCTAAAAGTAGAGCAAAAACAW
TAGAtgctcattatattttaatgtttgacgAAGATGctacttcaaatatt
ttatctcgTCTTAAACTATATAAAGACATTAACCagatgTTATTAAATCA
TTGCACTTTAAAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGT
ATAATTGGTGTGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCA
TTTGTTGATATGGCAACAGCCATAGGACTTGtgaataggtattgtgcAAA
ATTACCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACAAT
CAGTAGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTCCA
ATTAATTCACCTATTAAACATGATATAcatggTCATCCAATGCCATGTGA
AATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGTGTAGACAACTTCATT
CTCAAGGTGAATTAGATGACACCCTTCAACCTATTACAAAAGAATCATTT
CATGCATTGTTCAATGCTGACGAAGTATTGCCAGACGCTGAAGATGCATT
AATACCTTGGGACACAGAAGAGCCTAGACCTGGAACAAATAAACGCCGCC
AATACTACTATAaaagaATTGCTGAGGCATTTAATGACTGTAGACCAGTT
GAAGGTAAAGCTTGTCATTTATATgctatattgttaaatatgaatTGTCC
TGTACCAGAAGAACAAAATACTAGAGGTCGAAGAATTCATCCACCCGAAG
AATCCATTCATGGGTTTGGTATACTTACAATGAAACACATTCCAAgtATT
CCGCCATTTCCCATATATACTCGATGTGGTGAAGTATATGTGAGTTTAAA
GCCTATAAAAACAGATATGTTTCTAACACAACATCAACTGGATAATATag
ccacatttttaaattatacgttCACCAATGTACTACGTTTGCAAAAATGT
CATGTGGCATTTGATCCAACTACTActcataattgttattatattgtgcc
AACTCTTCGAGatacaagtGGATTGATAGACATTGATTGGAAATTCCTAg
ataatatgcataaatgtaAAGATAATAAACTAAGTATTATAACTAATGAA
GATAGAATACATTTTCAACCTGATATTGAAGTATTGAAAGATGCTGTTGT
TACTCCTTGGTATAGAAATCAAGAACAACCCCAGTATTTCTATGTAGCAG
AGATTTGTACACATCTTAATCCAAAATCACCATTTCCTGGTTCTAtagaa
aactataaaacatttgAGGATTACTATTATCTTAAGTATAgattaaaaat
ccaaaatctTGAACAACCTCTTTTAGATGTGGATCATACTTCTGCAAGAC
TTAATTTTCTTACACCAAGGTATATGAATCGTAAAGGTGTAATTTTACCT
ACTAGTAGTGATGCAACTAAAAGAGCTAAACGAGATAATCTAAGTCAAAA
ACAAATTCTTGTTCCTGAACTTTGTAATGTTCATTTATTTCCAGCATCAA
TGTGGCGTAAAGCTGTTTCTTTACCATGTATACTATATCGCATTAATGCT
TTATTGTTAGCTGATGAAATTCGTACTATTGTTGCCAAGGATATATCTTT
AGGATTGGTTAACTTAAGTTTTGatCACATGTGGGAGCCTTTAGATTTTG
GTTGGACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAATT
AGTACGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTAGA
TGAAAAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTGGA
TGGAYATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaataat
attgatagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATGAT
TCAAAGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGATG
GGATTCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTAGA
AATACTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaataa
attattatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAATG
ACAATGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaacaa
attatagatttattttataaaaaagatgatgatattattataaatcgagA
AGTAAAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACCAT
GGGAATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTTTA
TCGGATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagtga
aatattcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGGTG
TGCAATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATCAT
CCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAATGC
AAATGATggaattaatttggaacgtttGGAAACTATCGgagattcatttt
taaaatatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTCAT
GAAGGTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAATTT
GTATCGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTACAA
AATTTGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTCAT
AAATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGGAA
TATGATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGAAG
AAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAAAT
ACCCCTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCTGA
TAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtgGTGCCTATTTGATAT
CTTGTGGTGCTCGTggagcattattatttatgtcttgGCTAGGAATAAAA
GTATTACCTACGCTACATGATTCAAAATTAGGTTATCTAAAACCCCCATC
ATCTCCAMTTCTACGTAATGTTGACGATCCCGAAGGCGAATTAACAAAGT
TGATGGATGGATTTGAATCTTTTGAACAGCATTTAGGATACCATTTTCAA
GATCGTAGTTATCTATTACAAGCAATGACTCATGCTTCTTATTACCCCAA
TCGTTTAACTGATTGTTATCAACGATTAGAGTTTTTGGGTGATGCAGTTT
tggattatttaattacGCGGCATTTATATGAAGACAAGCGACAACATTCA
CCTGGAGCTTTGACAGATCTTCGTTCAGCACTAGTCAATAACACAATTTT
TGCATCCCTTGCTGTTAGAAATGGTTTTCATaagtatttcaaacatttat
ccCCAGGTTTGGCTGAAGTTGTTTGTAGATTTGTAACCATACAAGAAGAG
AATGGCCATACTATTGATGAAGagttttattttttgggaGAAGATGATTG
TGAAGAAGCTGAAGACGTTGAAGTGCCAAAAGCCCTTGGTGATGTTTTTG
AATCGGTTGCAGGAGCAATTTATTTGGATAGTAATATGTCATTAGATACA
GTATGGAaagtttatcataaaataatggaaaatgaAATGGaaCAATTTAG
TAAAAACGTACCGAAATCTCCTATCAGAGAACTTCTAGAATTAGAACCAG
AAACTGCAAAATTTAGTAAACCTGAAAAGTTGGCAGATGGTCGACGAGTT
CGGGTTGTAGTTGAAATATTTGGCAAAGGAGAATTTAAAGGTATTGGTCG
TAATTATAGAATCGCTAAATGTACAGCGGCCAAATGTGCCTTAAAGCATC
TAAAGAAAAAGATAAAGAAATAG
back to top