rna3671 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507629.1
Unique Namerna3671
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:693741..707460 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507629.1
Productendoribonuclease Dcr-1, transcript variant X3
Model evidenceSupporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161280
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507629.1
GeneID107161280
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161280gene2480Diuraphis noxiageneJOTR01000065 692291..707460 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507629.1rna3671Diuraphis noxiapolypeptideJOTR01000065 693947..707340 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32114id32114Diuraphis noxiaexonJOTR01000065 693741..693768 +
id32115id32115Diuraphis noxiaexonJOTR01000065 693886..694027 +
id32116id32116Diuraphis noxiaexonJOTR01000065 694100..694228 +
id32117id32117Diuraphis noxiaexonJOTR01000065 695431..696303 +
id32118id32118Diuraphis noxiaexonJOTR01000065 696380..696513 +
id32119id32119Diuraphis noxiaexonJOTR01000065 696605..696836 +
id32120id32120Diuraphis noxiaexonJOTR01000065 696917..697068 +
id32121id32121Diuraphis noxiaexonJOTR01000065 697225..697366 +
id32122id32122Diuraphis noxiaexonJOTR01000065 699986..700222 +
id32123id32123Diuraphis noxiaexonJOTR01000065 700301..700480 +
id32124id32124Diuraphis noxiaexonJOTR01000065 701508..701721 +
id32125id32125Diuraphis noxiaexonJOTR01000065 701783..701955 +
id32126id32126Diuraphis noxiaexonJOTR01000065 702011..702195 +
id32127id32127Diuraphis noxiaexonJOTR01000065 702251..702504 +
id32128id32128Diuraphis noxiaexonJOTR01000065 702564..703925 +
id32129id32129Diuraphis noxiaexonJOTR01000065 703992..704309 +
id32130id32130Diuraphis noxiaexonJOTR01000065 704369..704589 +
id32131id32131Diuraphis noxiaexonJOTR01000065 704945..705110 +
id32132id32132Diuraphis noxiaexonJOTR01000065 706358..706433 +
id32133id32133Diuraphis noxiaexonJOTR01000065 707184..707460 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363115.1cds3574Diuraphis noxiaCDSJOTR01000065 707184..707340 +


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3671 ID=rna3671|Name=XM_015507629.1|organism=Diuraphis noxia|type=mRNA|length=5495bp|location=Sequence derived from alignment at JOTR01000065:693741..707460+ (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
tatttcattagaaGGTACAACAAATAagGAAATCTGAAAAAAGAAAATGG
ACTTTACTTGTTTTAGAAGAAACAGAAATTGATCAGTACATGTTTTCTAT
TGGACATTTGACAGATTTAAAACCATTAGACATCAGATCAGTCAATCATt
tggattttattaattatgagGTAATTATTACTACTGAAAACCTATGTTta
gaattatttgaaaaaaaatatttgcgatTTGACCAGCTTAACTTAGCTAT
ATTCAATAACTGCCAGAAAATAATTCAGGAAAATAGTACttattataaga
tttgcaATTTTATCAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTT
CATccattatttgaatttgattcTGATCCATTCTTTATTGaaaatcaatt
gaaatttatatcacACAAATTGATTTCATCTATCGAGACTGCCAGTGATA
TTGTTTCTATATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAA
TGTGCTATTCACACAGAAGATCTTACCAATATTAAGATAAAGACAATGGT
GCAGAGTTTAACTGAATTCTTAAATGACCATAATTATGAGCCTGCTATCA
TATATGGAGACGATGAAGAATTTGGTGaagaattaaaacaaatacctaAC
CCTAAAAATGAACCTTTACAAATGATAGCTGATTTTTTggagattttaaa
aacaatgggTCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATA
TGGTAGAAAAATTGAAAGTTAAAACTCCATATGAAAGACACTATGTTTTG
TTATGTATTGTTTCTACATTATTGATTCAAATAAGAGCCAcatttgatga
tattttttataattatagtaatattgataAAGTACTGAAATTTAGTTCTC
CTCGTGTATTACGAATTATTAATACTCTCAAACAATTTAAACCAAAATCT
TTTAAAGCAGATAGTAACAATGTTGAAGTATGTAAagatcaaaaagaaaa
aaaagatagaaCTATCAAATCTAAATCAATAAGACGTAATTGGAAATTAG
CTAGGAGATATGGAACTCATAGAAAACAAGGACGATCAAGAGATCCGTAT
GAAGAAACTGTTTGTGCTATAATTCTCGTAAACAACAAAATGACAGCttc
tattttgtattatttatttttaGATTTGAAAAACAGTAACAAAGAAGATT
TTGGTTGGATTCAACCTCAATACACAGTAGATAAAGAAGCAGATCCAATT
ACTGAACCTAAAGAATTTGAAATTGAACATAAAAAGCAAGAAGAAACTTT
AAGAAGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAACTAAAGTAT
TAGAAGCAGGAATTGATTTACCTCGATGTAATTtagtgattaattataat
ataccacttTCATACAAATCATATCTAAGGTCTAAAAGTAGAGCAAAAAC
AWTAGAtgctcattatattttaatgtttgacgAAGATGctacttcaaata
ttttatctcgTCTTAAACTATATAAAGACATTAACCagatgTTATTAAAT
CATTGCACTTTAAAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAG
GTATAATTGGTGTGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCAC
CATTTGTTGATATGGCAACAGCCATAGGACTTGtgaataggtattgtgcA
AAATTACCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACA
ATCAGTAGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTC
CAATTAATTCACCTATTAAACATGATATAcatggTCATCCAATGCCATGT
GAAATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGTGTAGACAACTTCA
TTCTCAAGGTGAATTAGATGACACCCTTCAACCTATTACAAAAGAATCAT
TTCATGCATTGTTCAATGCTGACGAAGTATTGCCAGACGCTGAAGATGCA
TTAATACCTTGGGACACAGAAGAGCCTAGACCTGGAACAAATAAACGCCG
CCAATACTACTATAaaagaATTGCTGAGGCATTTAATGACTGTAGACCAG
TTGAAGGTAAAGCTTGTCATTTATATgctatattgttaaatatgaatTGT
CCTGTACCAGAAGAACAAAATACTAGAGGTCGAAGAATTCATCCACCCGA
AGAATCCATTCATGGGTTTGGTATACTTACAATGAAACACATTCCAAgtA
TTCCGCCATTTCCCATATATACTCGATGTGGTGAAGTATATGTGAGTTTA
AAGCCTATAAAAACAGATATGTTTCTAACACAACATCAACTGGATAATAT
agccacatttttaaattatacgttCACCAATGTACTACGTTTGCAAAAAT
GTCATGTGGCATTTGATCCAACTACTActcataattgttattatattgtg
ccAACTCTTCGAGatacaagtGGATTGATAGACATTGATTGGAAATTCCT
AgataatatgcataaatgtaAAGATAATAAACTAAGTATTATAACTAATG
AAGATAGAATACATTTTCAACCTGATATTGAAGTATTGAAAGATGCTGTT
GTTACTCCTTGGTATAGAAATCAAGAACAACCCCAGTATTTCTATGTAGC
AGAGATTTGTACACATCTTAATCCAAAATCACCATTTCCTGGTTCTAtag
aaaactataaaacatttgAGGATTACTATTATCTTAAGTATAgattaaaa
atccaaaatctTGAACAACCTCTTTTAGATGTGGATCATACTTCTGCAAG
ACTTAATTTTCTTACACCAAGGTATATGAATCGTAAAGGTGTAATTTTAC
CTACTAGTAGTGATGCAACTAAAAGAGCTAAACGAGATAATCTAAGTCAA
AAACAAATTCTTGTTCCTGAACTTTGTAATGTTCATTTATTTCCAGCATC
AATGTGGCGTAAAGCTGTTTCTTTACCATGTATACTATATCGCATTAATG
CTTTATTGTTAGCTGATGAAATTCGTACTATTGTTGCCAAGGATATATCT
TTAGGATTGGTTAACTTAAGTTTTGatCACATGTGGGAGCCTTTAGATTT
TGGTTGGACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAA
TTAGTACGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTA
GATGAAAAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTG
GATGGAYATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaata
atattgatagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATG
ATTCAAAGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGA
TGGGATTCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTA
GAAATACTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaat
aaattattatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAA
TGACAATGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaac
aaattatagatttattttataaaaaagatgatgatattattataaatcga
gAAGTAAAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACC
ATGGGAATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTT
TATCGGATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagt
gaaatattcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGG
TGTGCAATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATC
ATCCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAAT
GCAAATGATggaattaatttggaacgtttGGAAACTATCGgagattcatt
tttaaaatatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTC
ATGAAGGTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAAT
TTGTATCGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTAC
AAAATTTGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTC
ATAAATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGG
AATATGATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGA
AGAAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAA
ATACCCCTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCT
GATAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtgGTGCCTATTTGAT
ATCTTGTGGTGCTCGTggagcattattatttatgtcttgGCTAGGAATAA
AAGTATTACCTACGCTACATGATTCAAAATTAGGTTATCTAAAACCCCCA
TCATCTCCAMTTCTACGTAATGTTGACGATCCCGAAGGCGAATTAACAAA
GTTGATGGATGGATTTGAATCTTTTGAACAGCATTTAGGATACCATTTTC
AAGATCGTAGTTATCTATTACAAGCAATGACTCATGCTTCTTATTACCCC
AATCGTTTAACTGATTGTTATCAACGATTAGAGTTTTTGGGTGATGCAGT
TTtggattatttaattacGCGGCATTTATATGAAGACAAGCGACAACATT
CACCTGGAGCTTTGACAGATCTTCGTTCAGCACTAGTCAATAACACAATT
TTTGCATCCCTTGCTGTTAGAAATGGTTTTCATaagtatttcaaacattt
atccCCAGGTTTGGCTGAAGTTGTTTGTAGATTTGTAACCATACAAGAAG
AGAATGGCCATACTATTGATGAAGagttttattttttgggaGAAGATGAT
TGTGAAGAAGCTGAAGACGTTGAAGTGCCAAAAGCCCTTGGTGATGTTTT
TGAATCGGTTGCAGGAGCAATTTATTTGGATAGTAATATGTCATTAGATA
CAGTATGGAaagtttatcataaaataatggaaaatgaAATGGaaCAATTT
AGTAAAAACGTACCGAAATCTCCTATCAGAGAACTTCTAGAATTAGAACC
AGAAACTGCAAAATTTAGTAAACCTGAAAAGTTGGCAGATGGTCGACGAG
TTCGGGTTGTAGTTGAAATATTTGGCAAAGGAGAATTTAAAGGTATTGGT
CGTAATTATAGAATCGCTAAATGTACAGCGGCCAAATGTGCCTTAAAGCA
TCTAAAGAAAAAGATAAAGAAATAGATCATAATCTATGTACTTTACATTA
TACAGTATTRATTGGAAACAAGTACATAAAGCGATATCtgttaaagaata
aaatttattttgtagttaataaagtaatacattcaattgttgatt
back to top

protein sequence of XM_015507629.1

>rna3671 ID=rna3671|Name=XM_015507629.1|organism=Diuraphis noxia|type=polypeptide|length=1762bp
MFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQL
NLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFI
ENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKI
KTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFL
EILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRA
TFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKD
QKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNK
MTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQ
EETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKS
RAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEI
FADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPI
WKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVC
RQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGT
NKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRI
HPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQ
LDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDID
WKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQY
FYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDH
TSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHL
FPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWE
PLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSD
DPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDL
DSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQL
WTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSL
LKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVN
KVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETI
GDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGER
MISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTD
KEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIG
AYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEG
ELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFL
GDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKY
FKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKAL
GDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELL
ELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKC
ALKHLKKKIKK.
back to top

mRNA from alignment at JOTR01000065:693741..707460+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3671 ID=rna3671|Name=XM_015507629.1|organism=Diuraphis noxia|type=mRNA|length=13720bp|location=Sequence derived from alignment at JOTR01000065:693741..707460+ (Diuraphis noxia)
tatttcattagaaGGTACAACAAATAaggtatttgttattttaaaactca TTCGAGAACTtgcttttaaaatttacaggttagtcataaaaattaaatat taatattaacaatgatcaaatgataaataaattgattttctatAGGAAAT CTGAAAAAAGAAAATGGACTTTACTTGTTTTAGAAGAAACAGAAATTGAT CAGTACATGTTTTCTATTGGACATTTGACAGATTTAAAACCATTAGACAT CAGATCAGTCAATCATttggattttattaattatgaggtttgtattaaat attataatctttttttcctcctaaaaaatgttttaaatattttgattttg gtcTTCCAGGTAATTATTACTACTGAAAACCTATGTTtagaattatttga aaaaaaatatttgcgatTTGACCAGCTTAACTTAGCTATATTCAATAACT GCCAGAAAATAATTCAGGAAAATAGTACttattataaggtatttaaattt tttctaatcagattaattattttgattaaagtaAAAACTCTATAAAACAG ACATCAGTAACAGACTTTTATCACTAAGAGATGTAAGTGCTGCATGTAGT AATGTAGTATGCATATATCGGGTGATTAATTTAATgcaagatattaattt tttgaaagtattaatgtttttgaaaatattcttttcaTGATTTCTAATCC TTTAAAACTAtacttttttctaaaataaatattaaaaaaattaattgtta tcatagtttgaattttgtctttaaaaacagaatatttttttaaggtactt ttatacataaaaatcaaatttaggatgagtatttatgagttataacttct AGACCAAAGCCTGTGAAACAGtggttcttaattttttttagttcatggca cactattatacattacaagTTTGCACAGCACACTCACCAACAAAAATGTA Aggaaataaattactgttttcaatattttttatcagcataaatacaaaaa tcagACATTTCTCGCGTCACAGCGGTTTTGGGAACCACTCCAGTAAAAta ttgatcaatttttttttttggggggggggatcaAGGTCTGGACCTTAAAC CTTCCTGGCTAGTTATAAAAAAGTATCAAAAGTTTGATGTGTGGAGCAGT AAATCAATATTTGGTGAGATAACCTCATACCATtccacttatttaaaatt ttaaatacttaaaagtcaaaaactactcattctaaatttaatttttatgt attgaaatacgagtatttagaaaaatattctgttggaatatgaaattaaa actgaatattGTCTTTCAAAAagataaaaatcttaaaaatgtttggcata aaaaatattttgtattttttagtgGCTAGAAaccatgaacattttttttt aaacatctatacattttgaaataatgagtgttcagtgattaaaaaaatca tccgATATTCAGCATTAGgcatagatataattttatttaatatgtattga tGAAATTTAGGAAATATCTAATCGGAATtcgcatattattttgatagtta TTCTCAAGGTGGCTATAGCCAATAATGAATAAACCCCTGTTCTGTAGGTA GGCCTTGGCAAACAGATGTCTTCAAATAGAGGTTTtactttatagtaaaa taatacgaAAGTAATGTTgaaattctttttatttttttagatttgcaATT TTATCAAGCCAAATAGTAAATGTAGAATATTGGGTATTGTTCATccatta tttgaatttgattcTGATCCATTCTTTATTGaaaatcaattgaaatttat atcacACAAATTGATTTCATCTATCGAGACTGCCAGTGATATTGTTTCTA TATTGCGTCACTGTTGTAAACCTAAAGAAGTTCTCATTGAATGTGCTATT CACACAGAAGATCTTACCAATATTAAGATAAAGACAATGGTGCAGAGTTT AACTGAATTCTTAAATGACCATAATTATGAGCCTGCTATCATATATGGAG ACGATGAAGAATTTGGTGaagaattaaaacaaatacctaACCCTAAAAAT GAACCTTTACAAATGATAGCTGATTTTTTggagattttaaaaacaatggg TCCATATTGTGCAGATAAAGCTGCCTTGACACTCCTGTATATGGTAGAAA AATTGAAAGTTAAAACTCCATATGAAAGACACTATGTTTTGTTATGTATT GTTTCTACATTATTGATTCAAATAAGAGCCAcatttgatgatatttttta taattatagtaatattgataAAGTACTGAAATTTAGTTCTCCTCGTGTAT TACGAATTATTAATACTCTCAAACAATTTAAACCAAAATCTTTTAAAGCA GATAGTAACAATGTTGAAGTATGTAAagatcaaaaagaaaaaaaagatag aaCTATCAAATCTAAATCAATAAGACGTAATTGGAAATTAGCTAGGAGAT ATGGAACTCATAGAAAACAAGGACGATCAAGAGATCCGTATGAAGAAACT GTTTGTGCTATAATTCTCGTAAACAACAAAATGACAGCttctattttgta ttatttatttttagtaagcatattttattttttatcagttaaattaattt aaaatgaagtaattattttattgtttttatcttcTTTAGGATTTGAAAAA CAGTAACAAAGAAGATTTTGGTTGGATTCAACCTCAATACACAGTAGATA AAGAAGCAGATCCAATTACTGAACCTAAAGAATTTGAAATTGAACATAAA AAGCAAGAAGAAACTTTAAGAAGGTttgattgtatacattttttataaaa gattattttcaataaactgTATTTGattgcaattaataatttagtataaa aatggtTATTTCAGGTTTCGACAAAGAGAATGTAATGTACTTATTGGAAC TAAAGTATTAGAAGCAGGAATTGATTTACCTCGATGTAATTtagtgatta attataatataccacttTCATACAAATCATATCTAAGGTCTAAAAGTAGA GCAAAAACAWTAGAtgctcattatattttaatgtttgacgAAGATGctac ttcaaatattttatctcgTCTTAAACTATATAAAGACATTAACCaggtaa aaattgattttaaataaataaattatttatctaaccaatacataatttaa aatggttttaaattatttttttctagatgTTATTAAATCATTGCACTTTA AAAGATATTGACATGGAAAAAGAAATCTTTGCGGACAGGTATAATTGGTG TGTTACGCCATTCAAACCAGGAAAAAAGGAAGATTCACCATTTGTTGATA TGGCAACAGCCATAGGACTTGtgaataggtattaatttatattattagtt catcatacatttttcataatattttatttgtgtttataacttataagtac taTTTTTATCTGACTGATTAATtcctatgttattataatgattgcattat atttcctaaaatatttataaatgtgttaatataggtattgtgcAAAATTA CCTAGTGATACTTTTACCAAATTATCTCCTATTTGGAAGATACAATCAGT AGTGTATGAAAATCAACCAATGTTTGTTTGTAGTATCCGACTTCCAATTA ATTCACCTATTAAACATGATATAcatgtaagtattatttatgcattatag AGAACTAGATTGTCATATTAACTAACTAAGAAACTCTAAATAGCTTATTG AACATAGTGGTGCTATGATGGACTTAAAGTGAAACCTCACACCTACTGGG TACTTAGGTGTGTAGcacatattcaatataataatatttttctcttttaa aacaattttaaatactattgatataaaaaaatgtgaagaaGCAGGTAACA CTGTGCTGTACATAGGTATCATGCGGATCACTGGATGTGTTAAATgtgat ttcaattttataaaattatcttatataaaatgCGGTTCTGAGTAAAGTCA ATCTGttagcctatattataataactaaaaccaCTATTCTCAGTTTAAGA AGCCAATTTCATGTAAATTTTAACTTAGAATatctattgaaaaatattgt gtttatttaattttttgatttttttttctctattcaTATCGACCTATAAG TTTTTTGCAAAAATGTTTGAAAGGCTTATTCTTAAAAGAATTCTGCCATA CATTTCTTCAAGTAACATACTTCCAAATACTCAATTTGGCTTTCTTGTCT CTCATTCCACAACTCATCAACTACATAGATTAGTCGATACCATTTCGTTC TCacttgaaaagaaaaaatactgCTCGTGCGTGTTCCTTGATGTCTCTCA AGCCTTTGATAGGGTTTGGCATGAAGGGCTGTTATATAAACTAAAAGCTT TTCTTCCcccaacatattttttactcattaaaTCTTATTTTGCGGAACGT CACTTTTAAGTCAAGTTTGGCTCTTccttttcaaaaattgaaaaaattag tgCAGGAGTCCCTCAAGGTGGCATTGTTCAccaatactatataatgtata tgcaaCAGACCAACCTACCTCTCCATCAACATCTGTAGCTGAATTTACGG ATGATAAGGCAATTATATCAGTACACGAAGACCCACACATTGTTTCTCTA AatcagcgtttcttaaacttttttatccgtgAAACACTTTTTAATGTCCA CTTTTATCGTGGAACCCCTACTTCTTTTtagctttttagtttttttttag gattatttgcaaataaattataatattaagtagaagtatagattattgaa tatattgagTTATCTGATAGATTATTCCATAtggcttatacattattatt taatatacaagtattattttccataatggatattttaaagtaattttctt gaacatttaaaaaaaattacttaagcttTGCGGAACCCTGAAGTGATCTA CGTGGAACCCCAAGGTTCCGCGgaacacagtttaagaaacgctgctTTAA ATCTTCAAAACCACCTTGACCTAATGTCTGTCTGGTATGAAAAATTGTGA GTTCAAGTCAACCAATCAAAATCCATTCACAGTACGTTCACTCTTCGTCT CCCTTAGTAACATACCAATCCCTTCATCCCATTCGGTTAGGTACTTAGGG CTAACCTTTGACCGTCGCCTCACCTGGGGACTTCATATCAGAACTAAAAA ACTAGCTCTAAACGAACGACTTCGCTCAATTAAAACACTAATATCTAACA AGCATACTAAACACCAAACTTCtcatatataaatcattaattaaggCCTT GTGGACTTATGGCCWACAACTATGGGacaatgcaaaaaaaaactaatgta aataaaatccaaaccgttcaaaataaaatcttaagaTTAATCACTAACGC CCCTCCTTATGTCTCCAACTACACTCTGCACACagatttaaatactaaaa cagTTCACGATGAAGCAATAACATATTGCAAAAGATTCCATAACAGACTT CCATATCATCCTAATCACCTTATATCCAATTTAGCTTCTCGCACAATTCC AGGCAATCCCACCCAACGACTGAAAAGAAAATGGTGTCgagatttacaat ttaaataaataaattaaaattatataaaataaaaagttattaataaacaa ataagtagTGCTTTCACTGGATGGCTTCTTTCCTCACgttttcatgttaa aaaaaatattatatctcacATTTTTATTGTGCTCAAGGCTACAGATTGTA TAttctttgttaaaaaaaaaaaaagatttttgacTTCTACTTATGTGGaa cattgttttcatttttaagagGGCGCAACAACTGTATTTGTTGTGTCAGT CGTAACAAGgcgtaacataataaatttatgctcAGCACTTCACGATTTAT TCCGTTAGCTTAGAAGTTAGAGTGAATAGGCCTTTTAAAAGCGTAACGTA AAACACAGMtaatgtttttaccatcaagtttcataattggtctattcact ctaatttttaagctaacgaaataaaatgtgaactgctgagcataaatttg ttatgttacgcgtttgtaagattGAGACAACAATACGGGTGTTGCACCCT CTTAATTCTTGGTTATAAAACtgaacatcaaaataatttgcaaaatttTT GTGATTCTGATGAATTTTGTTACTAATAACatttggtaattattaattaa gattgATTTAAGCCATTATTCTCATTCCCAATTGatgtaaaataaactat tatagtattatttgattaaatattaatttttaattttttttacagggTCA TCCAATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGT GTAGACAACTTCATTCTCAAGGTGAATTAGATGACACCCTTCAACCTATT ACAAAAGAATCATTTCATGCATTGTTCAATGCTGACGAAGTATTGCCAGA CGCTGAAGATGCATTAATACCTTGGGACACAGAAGAGCCTAGACCTGGAA CAAATAAACGCCGCCAATACTACTATAaaagagtataaataatattttaa acatctaaTATTGAATTGTGTTTTAAAGTAATTTcctaacaattataaaa tttttactagATTGCTGAGGCATTTAATGACTGTAGACCAGTTGAAGGTA AAGCTTGTCATTTATATgctatattgttaaatatgaatTGTCCTGTACCA GAAGAACAAAATACTAGAGGTCGAAGAATTCATCCACCCGAAGAATCCAT TCATGGGTTTGGTATACTTACAATGAAACACATTCCAAgtgtaagtaaat atttataaatgaaaatataatatgtatttatatgtatacttatacaataa gTTCTCGTTTAACTTCTTAGTTAGTTTAGGTtcctaaaaaacaaaacatt atgtgaaataaaatgataaatgaaatattgtttcatttttgtaatgggtg atttACTTAATGATTACTTAAAAAACactgaaaaaatgttttgtctatgt tgagcATGGACCAGAGAGAAAAAACAAATGACTGTGCTTTGACATCCTCT TAAACAACTTATTACCAAAAAAATGAAGAATcaatacgaaatattatgta catatagtataattacaGCCCTCAGAAACACAATGCCAGTCGAGATGATA CCTAGTGTTAGTCTTGAAGGAAATACACCTGGATGGTACGTTGCTACACT GTATAAACTTATTGATTTAAGATAGATATTGggcatagtatattaaattc agGTACAATGTGCATAAACTGGTGCATAGAGACCAACACTGAGGTCCAGA AAAgtctaacttaacctaacctttgGAATATGTAAGATGacttttaatca atattttaatttttaagtgagataatatgagcattttaaataatatttct caaaCCCATTTCttgctttaatattaaaacattgaaaattctACTGTATA CTGTACTCTATAWGCTCTTACCTAAATGTTTGATACTAGATTAATTCACT cttatatcaaatatcaaaactaacagcacactattgaaactagtAAGCCA CATTTGTTatattgtacgtttgtaagacgtaTACAACAAGTGCATAGGTA GTGTCCTTTTAAGAGTGTATGCACTACACACAATTAAATAACATACAGTC CAATATAATAGAAACATTATACTGGAACTATTATACTGTTAAATGGAACA CaaggtattaaaattgtatgacttGATAGAAAAGCAATGTTAAACAAGGa cttactgtatatattatattggttataactttataagttataacttggAA ATCAAATAACTTTTTAGATTCCGCCATTTCCCATATATACTCGATGTGGT GAAGTATATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACA ACATCAACTGGATAATATagccacatttttaaattatacgttCACCAATG TACTACGTTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcat aattgttattatattgtgccAACTCTTCGAGGTTGTATGCATCAAATTAT TGATGGTTATAAAAGCTATAAAATGtgattgatatattatagatacaagt GGATTGATAGACATTGATTGGAAATTCCTAgataatatgcataaatgtaA AGATAATAAACTAAGTATTATAACTAATGAAGATAGAATACATTTTCAAC CTGATATTGAAGTATTGAAAGATGCTGTTGTTACTCCTTGGTATAGAAAT CAAGAACAACCCCAGgtattttctaaacaatttgaatatttataataatt aatcttatttttcTGTTTAGTATTTCTATGTAGCAGAGATTTGTACACAT CTTAATCCAAAATCACCATTTCCTGGTTCTAtagaaaactataaaacatt tgAGGATTACTATTATCTTAAGTATAgattaaaaatccaaaatctTGAAC AACCTCTTTTAGATGTGGATCATACTTCTGCAAGACTTAATTTTCTTACA CCAAGGTTTGCtagtatacataaattataaaaWttttttttatattttaa ttgtttgcaGGTATATGAATCGTAAAGGTGTAATTTTACCTACTAGTAGT GATGCAACTAAAAGAGCTAAACGAGATAATCTAAGTCAAAAACAAATTCT TGTTCCTGAACTTTGTAATGTTCATTTATTTCCAGCATCAATGTGGCGTA AAGCTGTTTCTTTACCATGTATACTATATCGCATTAATGCTTTATTGTTA GCTGATGAAATTCGTACTATTGTTGCCAAGGATATATCTTTAGGATTGGT TAACTTAAGTTTTGGTAAAGACCATAAACTTACTAAATATTTTctgtata ctaattatttttacatttaatagatCACATGTGGGAGCCTTTAGATTTTG GTTGGACCATGAaagatgtattaataaaaagaaaagaacAAAAAGAAATT AGTACGATAAAAGTTGCTGAACCAGTTGAAACTGTTAAGCAACTTGTAGA TGAAAAGATAAAAGAAGAAAAGATAGATAAATCAGATGATCCTAATTGGA TGGAYATTGGAACATGGTCTAATGATATGGCTGACTTtgcaatgaataat attgatagtaCGACAAAAGTAAGGTATTCATCACCTACTAGTTGGATGAT TCAAAGTGATAATGAATCAAGCACGTTCAGTGATCTTGATTCAGATGATG GGATTCAAGTTAATGGTTTACACTCTAATGGTTTACGAATAGAATTTAGA AATACTTATTTAGCTGAAGCTGTGGATGAAAATGAttccaaaacaaataa attattatttttccaaaacaaTGAAACTCCTCAATTGTGGACTTGGAATG ACAATGGTCACTCTGTAACTGAATATAATTCTAATCAACAAGACAaacaa attatagatttattttataaaaaagatgatgatattattataaatcgagA AGTAAAAAGTAGTACCAATATTGACAGCTTATCTTTATTAAAACTACCAT GGGAATTAAATGCAAATACTGGTTATGGACTTTCAGACATCAATGTTTTA TCGGATAAAACTTCATTTATCCCTGAAgatgataatgatattaaaagtga aatattcataaaaaataaaacattcgatAGTGTCAATAAAGTTCATGGTG TGCAATCTGAAACATTTAGTTTTGATTTTCAGCCAGACTTAAACAATCAT CCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAACTATGTCAAATGC AAATGATggaattaatttggaacgtttGGAAACTATCGgagattcatttt taaaatatgccaTTACAGCTTACTTATACTGTACCCATGATAATGTTCAT GAAGGTAAATTGAGCCATCTTAGATCAAAACAAGTCAGTAATTTGAATTT GTATCGTCTTggtaaactaaaaatgtttggCGAACGTATGATATCTACAA AATTTGAACCTCATGATAATTGGTTACCACCTTGTTATTTTGTCCCTCAT AAATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAACAACTTTATGGAA TATGATAACACTTCCCACATTTAAGGATCCTACAGATAAAGAAATTGAAG AAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGAGGACAAAGAAAAT ACCCCTTTATTTGTGCCATACAACCTTGTTACTCAACATAGTATTCCTGA TAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtggtatagtaaatataa ttatttatcagtatAACCATCAAATTTTTCCTAAAATGTTTCCTTTTCTA GGTGCCTATTTGATATCTTGTGGTGCTCGTggagcattattatttatgtc ttgGCTAGGAATAAAAGTATTACCTACGCTACATGATTCAAAATTAGGTT ATCTAAAACCCCCATCATCTCCAMTTCTACGTAATGTTGACGATCCCGAA GGCGAATTAACAAAGTTGATGGATGGATTTGAATCTTTTGAACAGCATTT AGGATACCATTTTCAAGATCGTAGTTATCTATTACAAGCAATGACTCATG CTTCTTATTACCCCAATCGTTTAACTGATTGTTATCAACGATTAGAGTTT TTGGGTGATGCAGTTTtgggtaaatataaaaagaatataatagttgattt taattctaaatttaatttaaaattttagattatttaattacGCGGCATTT ATATGAAGACAAGCGACAACATTCACCTGGAGCTTTGACAGATCTTCGTT CAGCACTAGTCAATAACACAATTTTTGCATCCCTTGCTGTTAGAAATGGT TTTCATaagtatttcaaacatttatccCCAGGTTTGGCTGAAGTTGTTTG TAGATTTGTAACCATACAAGAAGAGAATGGCCATACTATTGATGAAGagg tacctaactattattcaaacatatatctttatttttattttgctatgcGT ATTTATGGTAAAAGTTgtacttttatgaatttatttaacgtTAAAACTAC ACACATctttaaaacagtatttttagtttaagtattaagactaacatttt aatacaatgttacttatattttattcaatcgaTTTCAAAATTAGTTCATA TAAATACTAGATTTCtacttaaaatcatttttttgtaatcTTCATTGATC AttgatcttaaataataaaatgctggATTAACTTAATTTTGAGTGCTAAT AATGGATTTTCCCACAActcaatgaaatatataaacttttaaaacatttt ttagttttattttttgggaGAAGATGATTGTGAAGAAGCTGAAGACGTTG AAGTGCCAAAAGCCCTTGGTGATGTTTTTGAATCGGTTGCAGGAGCAATT TATTTGGATAGTAATATGTCATTAGATACAGTATGGAaagtttatcataa aataatggaaaatgaAATGGGTaaggttacatattattatgatcacttaa atattatcaatttttttttttaccttaatgcttcaaaaatatgtatttgt ttatgagcaaatttaatgttttagtattttttaaataatttttataagct aTGTTAGTGTAGTTGTAAAAACCAAGTACAGTAGAACTTCGATTAACCGT CACTGTCGGGACCGGGGCTATGACGGTTAATCGAATAGACGGTTAACGga aattttgcaaaaaaaaaaacgtgtacatacatatacacacatttattata ttttttacgtgtgtgtactttaaaaataatacatataaaaaaaatataac atataaattaattattgtaacacATATAAACACGACACATAAACTACGAA AACACTAATACACACGGTACACACTTACACGTAGGCTGTTCGTCGGTCAc tgattaaattacaatacatacatacatagtacaatacatacacacataaa ttTATAGTTCGTTTATCACATTTATCGCTTATATtggatatgtatatatt acaaactatttttatacacttGATAGTTACTGTGTTGGGCACCACGACGA GTTTATCACAATcgtctaattattttttttttcggcgaTGACCGATGACG GATAACAGAGAGTGACGGTAGTTctactgtattattaaatattaaaaata gtttatataatacaaaacaaatacttaaatatttaaaaattgtttctctG AGTGAAgcatcttaattattatattaaaacatttaaaatggctaaaaaaa tagtatgtggTGTCAACACAAGCATTATGCTTAAAGGGGAGTTGAAAACA TGTATTTAAAACacatatgacaattttttttttagtcattaaaCCAACCT ACCTACCCACCAGAACCGcttacaaactaaaaattatattcttcaaAACG ATATAGAACAGTTAatgatctattattttattctatagtccctttttttt aaacattatagctactacctagtacctacccaCCCATTTATTTAGCTATG ACATTTGTCATAGGCAAAACCTACTTTTRGCGTCCCTGAATGGcctgaat attaataaatatgtaccttAAACAAGCCTCAAGTAGTGAAAACTATTAAt taccaataattaatataataattaattactaaatgcttgatatttattat agttaatgtttttaattttataaataaatgcttgaatatatgttatatgt tattatttatgttatagaaCAATTTAGTAAAAACGTACCGAAATCTCCTA TCAGAGAACTTCTAGAATTAGAACCAGAAACTGCAAAATTTAGGTgagta acatttaaaaaataatatcaaaaaattgttatttggtAGGAACATAGTAC TAGTGTAGGTTTGCTACATAGaaagtgcatattatatgtcatttgaatat tttttttcagttacatAATTTAAAGATGATGGAAACATGGGTTAATTYGA TATACTTAGTGCGATTTAACTTATTAGCATGAGAGATTTTgaccatacaa tttttttgtctatgcatacattatttttttaataatattgagtacTTATG AACAATTGTATAGAAGAGGTTTTGAGCATAGGCACAAATAGGGAGGGGGG CTTTAGGAGCTAAGGCCCCTAACTAAACCTttcttaaatgttatattaag cttattaaatattagtaaaattaggTTTTAAACCCCCGGGGGGCCATATC TCAAACACTATTTGCGCATATGGCTTCTgagattttgttatatttagtag aactattttttttatcaactataaagtatattttatYatttatattcaaa attatttacggtatggaataattaattttacttattcccaaatattttat tataacgttaATAGAGTCAAACAACATTTGACCTAAAAACATTTTGGAGA CCGATTATGCTAAATTGTTatgctattaaaaaaagttgttgTTTGTAGTA GAGTACATGCATATAACCTAATAATCAGAAAATGTGTTAATTtcttagta tatttaatattataaaagatggATTTTTTTCTATTRTTTCTAGTAAACCT GAAAAGTTGGCAGATGGTCGACGAGTTCGGGTTGTAGTTGAAATATTTGG CAAAGGAGAATTTAAAGGTATTGGTCGTAATTATAGAATCGCTAAATGTA CAGCGGCCAAATGTGCCTTAAAGCATCTAAAGAAAAAGATAAAGAAATAG ATCATAATCTATGTACTTTACATTATACAGTATTRATTGGAAACAAGTAC ATAAAGCGATATCtgttaaagaataaaatttattttgtagttaataaagt aatacattcaattgttgatt
back to top

Coding sequence (CDS) from alignment at JOTR01000065:693741..707460+

>rna3671 ID=rna3671|Name=XM_015507629.1|organism=Diuraphis noxia|type=CDS|length=5286bp|location=Sequence derived from alignment at JOTR01000065:693741..707460+ (Diuraphis noxia)
ATGTTTTCTATTGGACATTTGACAGATTTAAAACCATTAGACATCAGATC
AGTCAATCATttggattttattaattatgagGTAATTATTACTACTGAAA
ACCTATGTTtagaattatttgaaaaaaaatatttgcgatTTGACCAGCTT
AACTTAGCTATATTCAATAACTGCCAGAAAATAATTCAGGAAAATAGTAC
ttattataagatttgcaATTTTATCAAGCCAAATAGTAAATGTAGAATAT
TGGGTATTGTTCATccattatttgaatttgattcTGATCCATTCTTTATT
GaaaatcaattgaaatttatatcacACAAATTGATTTCATCTATCGAGAC
TGCCAGTGATATTGTTTCTATATTGCGTCACTGTTGTAAACCTAAAGAAG
TTCTCATTGAATGTGCTATTCACACAGAAGATCTTACCAATATTAAGATA
AAGACAATGGTGCAGAGTTTAACTGAATTCTTAAATGACCATAATTATGA
GCCTGCTATCATATATGGAGACGATGAAGAATTTGGTGaagaattaaaac
aaatacctaACCCTAAAAATGAACCTTTACAAATGATAGCTGATTTTTTg
gagattttaaaaacaatgggTCCATATTGTGCAGATAAAGCTGCCTTGAC
ACTCCTGTATATGGTAGAAAAATTGAAAGTTAAAACTCCATATGAAAGAC
ACTATGTTTTGTTATGTATTGTTTCTACATTATTGATTCAAATAAGAGCC
AcatttgatgatattttttataattatagtaatattgataAAGTACTGAA
ATTTAGTTCTCCTCGTGTATTACGAATTATTAATACTCTCAAACAATTTA
AACCAAAATCTTTTAAAGCAGATAGTAACAATGTTGAAGTATGTAAagat
caaaaagaaaaaaaagatagaaCTATCAAATCTAAATCAATAAGACGTAA
TTGGAAATTAGCTAGGAGATATGGAACTCATAGAAAACAAGGACGATCAA
GAGATCCGTATGAAGAAACTGTTTGTGCTATAATTCTCGTAAACAACAAA
ATGACAGCttctattttgtattatttatttttaGATTTGAAAAACAGTAA
CAAAGAAGATTTTGGTTGGATTCAACCTCAATACACAGTAGATAAAGAAG
CAGATCCAATTACTGAACCTAAAGAATTTGAAATTGAACATAAAAAGCAA
GAAGAAACTTTAAGAAGGTTTCGACAAAGAGAATGTAATGTACTTATTGG
AACTAAAGTATTAGAAGCAGGAATTGATTTACCTCGATGTAATTtagtga
ttaattataatataccacttTCATACAAATCATATCTAAGGTCTAAAAGT
AGAGCAAAAACAWTAGAtgctcattatattttaatgtttgacgAAGATGc
tacttcaaatattttatctcgTCTTAAACTATATAAAGACATTAACCaga
tgTTATTAAATCATTGCACTTTAAAAGATATTGACATGGAAAAAGAAATC
TTTGCGGACAGGTATAATTGGTGTGTTACGCCATTCAAACCAGGAAAAAA
GGAAGATTCACCATTTGTTGATATGGCAACAGCCATAGGACTTGtgaata
ggtattgtgcAAAATTACCTAGTGATACTTTTACCAAATTATCTCCTATT
TGGAAGATACAATCAGTAGTGTATGAAAATCAACCAATGTTTGTTTGTAG
TATCCGACTTCCAATTAATTCACCTATTAAACATGATATAcatggTCATC
CAATGCCATGTGAAATTTTAGCAAAAAGAATAGCTGCATTAGAAGTGTGT
AGACAACTTCATTCTCAAGGTGAATTAGATGACACCCTTCAACCTATTAC
AAAAGAATCATTTCATGCATTGTTCAATGCTGACGAAGTATTGCCAGACG
CTGAAGATGCATTAATACCTTGGGACACAGAAGAGCCTAGACCTGGAACA
AATAAACGCCGCCAATACTACTATAaaagaATTGCTGAGGCATTTAATGA
CTGTAGACCAGTTGAAGGTAAAGCTTGTCATTTATATgctatattgttaa
atatgaatTGTCCTGTACCAGAAGAACAAAATACTAGAGGTCGAAGAATT
CATCCACCCGAAGAATCCATTCATGGGTTTGGTATACTTACAATGAAACA
CATTCCAAgtATTCCGCCATTTCCCATATATACTCGATGTGGTGAAGTAT
ATGTGAGTTTAAAGCCTATAAAAACAGATATGTTTCTAACACAACATCAA
CTGGATAATATagccacatttttaaattatacgttCACCAATGTACTACG
TTTGCAAAAATGTCATGTGGCATTTGATCCAACTACTActcataattgtt
attatattgtgccAACTCTTCGAGatacaagtGGATTGATAGACATTGAT
TGGAAATTCCTAgataatatgcataaatgtaAAGATAATAAACTAAGTAT
TATAACTAATGAAGATAGAATACATTTTCAACCTGATATTGAAGTATTGA
AAGATGCTGTTGTTACTCCTTGGTATAGAAATCAAGAACAACCCCAGTAT
TTCTATGTAGCAGAGATTTGTACACATCTTAATCCAAAATCACCATTTCC
TGGTTCTAtagaaaactataaaacatttgAGGATTACTATTATCTTAAGT
ATAgattaaaaatccaaaatctTGAACAACCTCTTTTAGATGTGGATCAT
ACTTCTGCAAGACTTAATTTTCTTACACCAAGGTATATGAATCGTAAAGG
TGTAATTTTACCTACTAGTAGTGATGCAACTAAAAGAGCTAAACGAGATA
ATCTAAGTCAAAAACAAATTCTTGTTCCTGAACTTTGTAATGTTCATTTA
TTTCCAGCATCAATGTGGCGTAAAGCTGTTTCTTTACCATGTATACTATA
TCGCATTAATGCTTTATTGTTAGCTGATGAAATTCGTACTATTGTTGCCA
AGGATATATCTTTAGGATTGGTTAACTTAAGTTTTGatCACATGTGGGAG
CCTTTAGATTTTGGTTGGACCATGAaagatgtattaataaaaagaaaaga
acAAAAAGAAATTAGTACGATAAAAGTTGCTGAACCAGTTGAAACTGTTA
AGCAACTTGTAGATGAAAAGATAAAAGAAGAAAAGATAGATAAATCAGAT
GATCCTAATTGGATGGAYATTGGAACATGGTCTAATGATATGGCTGACTT
tgcaatgaataatattgatagtaCGACAAAAGTAAGGTATTCATCACCTA
CTAGTTGGATGATTCAAAGTGATAATGAATCAAGCACGTTCAGTGATCTT
GATTCAGATGATGGGATTCAAGTTAATGGTTTACACTCTAATGGTTTACG
AATAGAATTTAGAAATACTTATTTAGCTGAAGCTGTGGATGAAAATGAtt
ccaaaacaaataaattattatttttccaaaacaaTGAAACTCCTCAATTG
TGGACTTGGAATGACAATGGTCACTCTGTAACTGAATATAATTCTAATCA
ACAAGACAaacaaattatagatttattttataaaaaagatgatgatatta
ttataaatcgagAAGTAAAAAGTAGTACCAATATTGACAGCTTATCTTTA
TTAAAACTACCATGGGAATTAAATGCAAATACTGGTTATGGACTTTCAGA
CATCAATGTTTTATCGGATAAAACTTCATTTATCCCTGAAgatgataatg
atattaaaagtgaaatattcataaaaaataaaacattcgatAGTGTCAAT
AAAGTTCATGGTGTGCAATCTGAAACATTTAGTTTTGATTTTCAGCCAGA
CTTAAACAATCATCCTGGGCCAAGTCCTAGTGTTCTACTTCAAGCATTAA
CTATGTCAAATGCAAATGATggaattaatttggaacgtttGGAAACTATC
GgagattcatttttaaaatatgccaTTACAGCTTACTTATACTGTACCCA
TGATAATGTTCATGAAGGTAAATTGAGCCATCTTAGATCAAAACAAGTCA
GTAATTTGAATTTGTATCGTCTTggtaaactaaaaatgtttggCGAACGT
ATGATATCTACAAAATTTGAACCTCATGATAATTGGTTACCACCTTGTTA
TTTTGTCCCTCATAAATTAGAAAAAGCTCTTATTAGTGCTAGTATACCAA
CAACTTTATGGAATATGATAACACTTCCCACATTTAAGGATCCTACAGAT
AAAGAAATTGAAGAAGTTATCCAACAGTTCAAAGTTGGTTTCTTAAATGA
GGACAAAGAAAATACCCCTTTATTTGTGCCATACAACCTTGTTACTCAAC
ATAGTATTCCTGATAAAAGTATTGCTGATTGCGTAGAAGCTTTAATtgGT
GCCTATTTGATATCTTGTGGTGCTCGTggagcattattatttatgtcttg
GCTAGGAATAAAAGTATTACCTACGCTACATGATTCAAAATTAGGTTATC
TAAAACCCCCATCATCTCCAMTTCTACGTAATGTTGACGATCCCGAAGGC
GAATTAACAAAGTTGATGGATGGATTTGAATCTTTTGAACAGCATTTAGG
ATACCATTTTCAAGATCGTAGTTATCTATTACAAGCAATGACTCATGCTT
CTTATTACCCCAATCGTTTAACTGATTGTTATCAACGATTAGAGTTTTTG
GGTGATGCAGTTTtggattatttaattacGCGGCATTTATATGAAGACAA
GCGACAACATTCACCTGGAGCTTTGACAGATCTTCGTTCAGCACTAGTCA
ATAACACAATTTTTGCATCCCTTGCTGTTAGAAATGGTTTTCATaagtat
ttcaaacatttatccCCAGGTTTGGCTGAAGTTGTTTGTAGATTTGTAAC
CATACAAGAAGAGAATGGCCATACTATTGATGAAGagttttattttttgg
gaGAAGATGATTGTGAAGAAGCTGAAGACGTTGAAGTGCCAAAAGCCCTT
GGTGATGTTTTTGAATCGGTTGCAGGAGCAATTTATTTGGATAGTAATAT
GTCATTAGATACAGTATGGAaagtttatcataaaataatggaaaatgaAA
TGGaaCAATTTAGTAAAAACGTACCGAAATCTCCTATCAGAGAACTTCTA
GAATTAGAACCAGAAACTGCAAAATTTAGTAAACCTGAAAAGTTGGCAGA
TGGTCGACGAGTTCGGGTTGTAGTTGAAATATTTGGCAAAGGAGAATTTA
AAGGTATTGGTCGTAATTATAGAATCGCTAAATGTACAGCGGCCAAATGT
GCCTTAAAGCATCTAAAGAAAAAGATAAAGAAATAG
back to top