rna3672 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507631.1
Unique Namerna3672
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:710623..712689 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507631.1
ProductUDP-N-acetylhexosamine pyrophosphorylase
Model evidenceSupporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
GeneLOC107161282
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507631.1
GeneID107161282
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161282gene2481Diuraphis noxiageneJOTR01000065 710623..712689 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507631.1rna3672Diuraphis noxiapolypeptideJOTR01000065 710841..712298 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363117.1cds3575Diuraphis noxiaCDSJOTR01000065 710841..712298 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32134id32134Diuraphis noxiaexonJOTR01000065 710623..712689 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3672 ID=rna3672|Name=XM_015507631.1|organism=Diuraphis noxia|type=mRNA|length=2067bp|location=Sequence derived from alignment at JOTR01000065:710623..712689- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
TTAGTTTGATAAGTTTTTATCAGTTAACCGCCATAAAATTATTTTAGAAA
GTGAAAAGTGGAAGATTTGAGCTCAACGTGTCCTGCAATGCTGCATTGCT
GGCTGCTGCAGGCTACACTCAAATACTCAATTAGTATTTACTATTTAGTC
AGCAGGCTGCAGTGGCCAATCGACTCTGCCCAGTGCCCCAGTGTCCACTT
GGCAGTTGGTGCCTAGAAGCTTAGCATATTTTAGGAAATTCTTTTGTAGC
TTATATTTTGTAGTTAGTTGTTAAATACATTTGAAAATTTTCTTAAATTA
TTGGTGATTGTTTTTTATATGATTTAGGCACAGAATAGATTAGGTATTTA
AATAAAATATTTATTTCATACTACAGTTTGCATTATTGTTAATGATGTCT
GACTTTGATTCTATAATTGCATTGCTTAAAAAATATGATCAAGAACATAT
TATTACATTTTGGAACAGACTTAATGAAAAAGAAAAAGAATTTCTCCTAG
ATGATATTCGTGAACTGAACATTCCTGAAGTTGTTGGAATGTTTAAAAAA
AMTTTAGGAACTATGAGTGCCAATCAACAAAAATTGGATAATAAGATGAA
TCCTATATCTGCTGAATTATATGGTGCTGTAAACCGCAGCCCAAAAGAAC
TTTTGATTAAATATGAGCAAATTGGACTTGAACAGATATCTCAAGGCAGA
GTTGGAGTCTTGTTAATGGCTGGAGGACAAGGTACAAGACTTGGAGTTAA
CTACCCTAAAGGTATGTATGACATTGGTTTGCCTTCTCATAAATCGTTGT
ACCGTATACAAGGGGAACGTATTCGCTGCCTGATTAGGCTAGCTAATAAA
GATTTTGGATGCTGTAAAGGTTTACCTTGGTTTATAATGACTAGTGAACA
TACTATGGAACCTACTCGTAAATACTTCAAGGAAAATAATTATTTTGGCC
TAGATGAAAAAAAAATTATATTTTTTGAACAATATATGTTGCCAGCATTT
ACATTTGATGGAAAAATCATTATGGAAAGTATGAATAAAATATCTAAATC
TCCAGATGGTAATGGTGGTATATTTAAAGCTTTACGTGATCGCAAAGTAT
TGGATGAGATTAAAAGCCTAGGTGTTCAATACCTCCATGCTCATAGTGTA
GATAATATATTAGTTAAGGTAGCAGATCCAATATTTATTGGATACTGCAT
AACAAAAAATGCTGAATGTGGGGCAAAAGTTGTAGAAAAAGCATATCCTT
CTGAGCCACTAGGTGTTGTATGTGAAGTTGATGGGAAATTTCAAGTTGTT
GAATATAGTGAAATTACTGAAAATACAGCTGAAAAAAGAAATTCTGATGG
TCGTTTAACCTTTAGTGCTGGTAATATTTGCAATCATTTTTTTACAACAG
ATTTTTTAAATAATGTTGCATATAAATATAATAGTAAATTAAAATTGCAT
GTGGCTAAAAAAAAAATACCTTATGTGAATGGTAATGGAATTGTATGCAA
ACCAGAAGAACTTAATGGTATTAAAATGGAAAAATTTATATTTGATGTCT
TTGAATTTTGTAATCGTCTTGCTGTTTGGGAAGTAGAAAGAGATGAAGAA
TTTAGCGCTTTAAAAAATGCAGATATTCCTAATGGTAAAGATAACCCTAA
AACTGCACGCTTAGATGTCTTTTCACTTCATAGAAAATTTGTTGAAAAAT
CTGGAGGAAAATTTATAACTGAAAACATTGAATGTGAGATTTCACCTCTA
TTATCTTATGCTGGTGAAAATCTTAAGCACTTGGTTGATGGAAAAATTTT
CAATTCTGCACTAGAATTAAAATCTGCCGAAGAAATATCTAATAAATAAT
AATAATAATTCTAATGTATATTAAATGATTGTTTTACTCATACCTTAAGT
GGAGCTATTCTTTAAGTTTATTTTATGATTTATTTTATTTTAACAAGTAG
GTATAAGTTTTCTACATTCATACAAGTTGAATTTTGTTTTTCAAATGTGT
AACTACTTATTACACAAAAATGGCCTAATGTTTAAAATTTGTTTTAAATC
ATATACTTTTATGAGTT
back to top

protein sequence of XM_015507631.1

>rna3672 ID=rna3672|Name=XM_015507631.1|organism=Diuraphis noxia|type=polypeptide|length=486bp
MMSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGM
FKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQIS
QGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRL
ANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYML
PAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHA
HSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKF
QVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKL
KLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVER
DEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEI
SPLLSYAGENLKHLVDGKIFNSALELKSAEEISNK.
back to top

mRNA from alignment at JOTR01000065:710623..712689-

Legend: exonCDSpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3672 ID=rna3672|Name=XM_015507631.1|organism=Diuraphis noxia|type=mRNA|length=2067bp|location=Sequence derived from alignment at JOTR01000065:710623..712689- (Diuraphis noxia)
TTAGTTTGATAAGTTTTTATCAGTTAACCGCCATAAAATTATTTTAGAAA GTGAAAAGTGGAAGATTTGAGCTCAACGTGTCCTGCAATGCTGCATTGCT GGCTGCTGCAGGCTACACTCAAATACTCAATTAGTATTTACTATTTAGTC AGCAGGCTGCAGTGGCCAATCGACTCTGCCCAGTGCCCCAGTGTCCACTT GGCAGTTGGTGCCTAGAAGCTTAGCATATTTTAGGAAATTCTTTTGTAGC TTATATTTTGTAGTTAGTTGTTAAATACATTTGAAAATTTTCTTAAATTA TTGGTGATTGTTTTTTATATGATTTAGGCACAGAATAGATTAGGTATTTA AATAAAATATTTATTTCATACTACAGTTTGCATTATTGTTAATGATGTCT GACTTTGATTCTATAATTGCATTGCTTAAAAAATATGATCAAGAACATAT TATTACATTTTGGAACAGACTTAATGAAAAAGAAAAAGAATTTCTCCTAG ATGATATTCGTGAACTGAACATTCCTGAAGTTGTTGGAATGTTTAAAAAA AMTTTAGGAACTATGAGTGCCAATCAACAAAAATTGGATAATAAGATGAA TCCTATATCTGCTGAATTATATGGTGCTGTAAACCGCAGCCCAAAAGAAC TTTTGATTAAATATGAGCAAATTGGACTTGAACAGATATCTCAAGGCAGA GTTGGAGTCTTGTTAATGGCTGGAGGACAAGGTACAAGACTTGGAGTTAA CTACCCTAAAGGTATGTATGACATTGGTTTGCCTTCTCATAAATCGTTGT ACCGTATACAAGGGGAACGTATTCGCTGCCTGATTAGGCTAGCTAATAAA GATTTTGGATGCTGTAAAGGTTTACCTTGGTTTATAATGACTAGTGAACA TACTATGGAACCTACTCGTAAATACTTCAAGGAAAATAATTATTTTGGCC TAGATGAAAAAAAAATTATATTTTTTGAACAATATATGTTGCCAGCATTT ACATTTGATGGAAAAATCATTATGGAAAGTATGAATAAAATATCTAAATC TCCAGATGGTAATGGTGGTATATTTAAAGCTTTACGTGATCGCAAAGTAT TGGATGAGATTAAAAGCCTAGGTGTTCAATACCTCCATGCTCATAGTGTA GATAATATATTAGTTAAGGTAGCAGATCCAATATTTATTGGATACTGCAT AACAAAAAATGCTGAATGTGGGGCAAAAGTTGTAGAAAAAGCATATCCTT CTGAGCCACTAGGTGTTGTATGTGAAGTTGATGGGAAATTTCAAGTTGTT GAATATAGTGAAATTACTGAAAATACAGCTGAAAAAAGAAATTCTGATGG TCGTTTAACCTTTAGTGCTGGTAATATTTGCAATCATTTTTTTACAACAG ATTTTTTAAATAATGTTGCATATAAATATAATAGTAAATTAAAATTGCAT GTGGCTAAAAAAAAAATACCTTATGTGAATGGTAATGGAATTGTATGCAA ACCAGAAGAACTTAATGGTATTAAAATGGAAAAATTTATATTTGATGTCT TTGAATTTTGTAATCGTCTTGCTGTTTGGGAAGTAGAAAGAGATGAAGAA TTTAGCGCTTTAAAAAATGCAGATATTCCTAATGGTAAAGATAACCCTAA AACTGCACGCTTAGATGTCTTTTCACTTCATAGAAAATTTGTTGAAAAAT CTGGAGGAAAATTTATAACTGAAAACATTGAATGTGAGATTTCACCTCTA TTATCTTATGCTGGTGAAAATCTTAAGCACTTGGTTGATGGAAAAATTTT CAATTCTGCACTAGAATTAAAATCTGCCGAAGAAATATCTAATAAATAAT AATAATAATTCTAATGTATATTAAATGATTGTTTTACTCATACCTTAAGT GGAGCTATTCTTTAAGTTTATTTTATGATTTATTTTATTTTAACAAGTAG GTATAAGTTTTCTACATTCATACAAGTTGAATTTTGTTTTTCAAATGTGT AACTACTTATTACACAAAAATGGCCTAATGTTTAAAATTTGTTTTAAATC ATATACTTTTATGAGTT
back to top

Coding sequence (CDS) from alignment at JOTR01000065:710623..712689-

>rna3672 ID=rna3672|Name=XM_015507631.1|organism=Diuraphis noxia|type=CDS|length=1458bp|location=Sequence derived from alignment at JOTR01000065:710623..712689- (Diuraphis noxia)
ATGATGTCTGACTTTGATTCTATAATTGCATTGCTTAAAAAATATGATCA
AGAACATATTATTACATTTTGGAACAGACTTAATGAAAAAGAAAAAGAAT
TTCTCCTAGATGATATTCGTGAACTGAACATTCCTGAAGTTGTTGGAATG
TTTAAAAAAAMTTTAGGAACTATGAGTGCCAATCAACAAAAATTGGATAA
TAAGATGAATCCTATATCTGCTGAATTATATGGTGCTGTAAACCGCAGCC
CAAAAGAACTTTTGATTAAATATGAGCAAATTGGACTTGAACAGATATCT
CAAGGCAGAGTTGGAGTCTTGTTAATGGCTGGAGGACAAGGTACAAGACT
TGGAGTTAACTACCCTAAAGGTATGTATGACATTGGTTTGCCTTCTCATA
AATCGTTGTACCGTATACAAGGGGAACGTATTCGCTGCCTGATTAGGCTA
GCTAATAAAGATTTTGGATGCTGTAAAGGTTTACCTTGGTTTATAATGAC
TAGTGAACATACTATGGAACCTACTCGTAAATACTTCAAGGAAAATAATT
ATTTTGGCCTAGATGAAAAAAAAATTATATTTTTTGAACAATATATGTTG
CCAGCATTTACATTTGATGGAAAAATCATTATGGAAAGTATGAATAAAAT
ATCTAAATCTCCAGATGGTAATGGTGGTATATTTAAAGCTTTACGTGATC
GCAAAGTATTGGATGAGATTAAAAGCCTAGGTGTTCAATACCTCCATGCT
CATAGTGTAGATAATATATTAGTTAAGGTAGCAGATCCAATATTTATTGG
ATACTGCATAACAAAAAATGCTGAATGTGGGGCAAAAGTTGTAGAAAAAG
CATATCCTTCTGAGCCACTAGGTGTTGTATGTGAAGTTGATGGGAAATTT
CAAGTTGTTGAATATAGTGAAATTACTGAAAATACAGCTGAAAAAAGAAA
TTCTGATGGTCGTTTAACCTTTAGTGCTGGTAATATTTGCAATCATTTTT
TTACAACAGATTTTTTAAATAATGTTGCATATAAATATAATAGTAAATTA
AAATTGCATGTGGCTAAAAAAAAAATACCTTATGTGAATGGTAATGGAAT
TGTATGCAAACCAGAAGAACTTAATGGTATTAAAATGGAAAAATTTATAT
TTGATGTCTTTGAATTTTGTAATCGTCTTGCTGTTTGGGAAGTAGAAAGA
GATGAAGAATTTAGCGCTTTAAAAAATGCAGATATTCCTAATGGTAAAGA
TAACCCTAAAACTGCACGCTTAGATGTCTTTTCACTTCATAGAAAATTTG
TTGAAAAATCTGGAGGAAAATTTATAACTGAAAACATTGAATGTGAGATT
TCACCTCTATTATCTTATGCTGGTGAAAATCTTAAGCACTTGGTTGATGG
AAAAATTTTCAATTCTGCACTAGAATTAAAATCTGCCGAAGAAATATCTA
ATAAATAA
back to top