rna3675 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507617.1
Unique Namerna3675
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:721817..722874 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507617.1
Productmitochondrial import inner membrane translocase subunit Tim9-like
Model evidenceSupporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
GeneLOC107161276
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507617.1
GeneID107161276
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161276gene2483Diuraphis noxiageneJOTR01000065 721817..722874 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507617.1rna3675Diuraphis noxiapolypeptideJOTR01000065 722162..722631 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363103.1cds3578Diuraphis noxiaCDSJOTR01000065 722162..722368 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id32153id32153Diuraphis noxiaexonJOTR01000065 721817..722368 -
id32152id32152Diuraphis noxiaexonJOTR01000065 722445..722540 -
id32151id32151Diuraphis noxiaexonJOTR01000065 722605..722874 -


Sequences
The following sequences are available for this feature:

spliced messenger RNA

>rna3675 ID=rna3675|Name=XM_015507617.1|organism=Diuraphis noxia|type=mRNA|length=918bp|location=Sequence derived from alignment at JOTR01000065:721817..722874- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon.  
ATTAATCATTATACGTAATGATCAAATTATAAAATAAAAATTTTCAATTT
CTGCTATTTGCAAGGCGCATGAGGCCATGAGGCAAGATCGCCAAGATACT
TAATATCAAATTCTCACTCAGTTCGTCAGACTTCTGATCCCGGTTTCAGT
AATAATCAACTTAAAGAAATATAACGTTTTTTACTTGAAATAGTAAAAGG
AAAATAATTAATTTGTGAAAATAGCAAATTCAGACATTTAGAAATGGACG
AAGAAGTTCAGTTAAAAAATATTAAAGAATTTTTACAAAATTATAACAAA
ATAACAGATGATTGTTTTTCTCAATGTGTGTATACTTTAACTCAAAGCAG
GTTAACAGGTGAAGAGGCATTGTGCGCAAGTAATTGTGTCCAGAAATCTA
AGTTTGTTGATCAAAAATGTATGCAAGCATTTATTGAGCATCAGCAACAA
TCAATGCAAAAATTTGTTGAAGAATCTTCTCAAAAACAAGCCGAACAGGA
AGCTACTGTTGTAGACTCAAATATTTCAGATACAGAAACTAAAGAAATAG
TAAAACAAGAATCAACAAAATAACAATTAGATTAAGACATTATGTAGGTT
TGAAATTAAATAATTTAGTATTTGTAAATATAATATAATTGATTGAATTA
AAATTAAAAAAAAAAATACTGTATTACTTCTACTAAACATGCTACCAATA
GCGATTTATTTTACAACCTTATCTTGACCTGAATTAAAAAAATATATGTC
TATAGTACACAAATTACAAACAAAATATAATAGTGATATAATATTATAAG
GTATATAACATTATTAACCAGTAGATTTATGTCAACCTTATAATTACATA
AAAATAGTTCAATTTGTGATGGAATTAATAAAATAAATACAACTCTTAAA
ATGCTTGATACTATAAGA
back to top

protein sequence of XM_015507617.1

>rna3675 ID=rna3675|Name=XM_015507617.1|organism=Diuraphis noxia|type=polypeptide|length=110bp
MDEEVQLKNIKEFLQNYNKITDDCFSQCVYTLTQSRLTGEEALCASNCVQ
KSKFVDQKCMQAFIEHQQQSMQKFVEESSQKQAEQEATVVDSNISDTETK
EIVKQESTK.
back to top

mRNA from alignment at JOTR01000065:721817..722874-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna3675 ID=rna3675|Name=XM_015507617.1|organism=Diuraphis noxia|type=mRNA|length=1058bp|location=Sequence derived from alignment at JOTR01000065:721817..722874- (Diuraphis noxia)
ATTAATCATTATACGTAATGATCAAATTATAAAATAAAAATTTTCAATTT CTGCTATTTGCAAGGCGCATGAGGCCATGAGGCAAGATCGCCAAGATACT TAATATCAAATTCTCACTCAGTTCGTCAGACTTCTGATCCCGGTTTCAGT AATAATCAACTTAAAGAAATATAACGTTTTTTACTTGAAATAGTAAAAGG AAAATAATTAATTTGTGAAAATAGCAAATTCAGACATTTAGAAATGGACG AAGAAGTTCAGTTAAAAAATGTATGCGATTAATTATTTTAACTGATTTTT AAATATTTTGTGTAATACTTATTTTTGTTTTCAGATTAAAGAATTTTTAC AAAATTATAACAAAATAACAGATGATTGTTTTTCTCAATGTGTGTATACT TTAACTCAAAGCAGGTTAACAGGTGAAGAGGTTAGTATACATTATACAAT AGACAATTGTTGTTATGATTCAGTCGCATAATTTAAGATTGTTAAAATAT TTGTAGGCATTGTGCGCAAGTAATTGTGTCCAGAAATCTAAGTTTGTTGA TCAAAAATGTATGCAAGCATTTATTGAGCATCAGCAACAATCAATGCAAA AATTTGTTGAAGAATCTTCTCAAAAACAAGCCGAACAGGAAGCTACTGTT GTAGACTCAAATATTTCAGATACAGAAACTAAAGAAATAGTAAAACAAGA ATCAACAAAATAACAATTAGATTAAGACATTATGTAGGTTTGAAATTAAA TAATTTAGTATTTGTAAATATAATATAATTGATTGAATTAAAATTAAAAA AAAAAATACTGTATTACTTCTACTAAACATGCTACCAATAGCGATTTATT TTACAACCTTATCTTGACCTGAATTAAAAAAATATATGTCTATAGTACAC AAATTACAAACAAAATATAATAGTGATATAATATTATAAGGTATATAACA TTATTAACCAGTAGATTTATGTCAACCTTATAATTACATAAAAATAGTTC AATTTGTGATGGAATTAATAAAATAAATACAACTCTTAAAATGCTTGATA CTATAAGA
back to top

Coding sequence (CDS) from alignment at JOTR01000065:721817..722874-

>rna3675 ID=rna3675|Name=XM_015507617.1|organism=Diuraphis noxia|type=CDS|length=330bp|location=Sequence derived from alignment at JOTR01000065:721817..722874- (Diuraphis noxia)
ATGGACGAAGAAGTTCAGTTAAAAAATATTAAAGAATTTTTACAAAATTA
TAACAAAATAACAGATGATTGTTTTTCTCAATGTGTGTATACTTTAACTC
AAAGCAGGTTAACAGGTGAAGAGGCATTGTGCGCAAGTAATTGTGTCCAG
AAATCTAAGTTTGTTGATCAAAAATGTATGCAAGCATTTATTGAGCATCA
GCAACAATCAATGCAAAAATTTGTTGAAGAATCTTCTCAAAAACAAGCCG
AACAGGAAGCTACTGTTGTAGACTCAAATATTTCAGATACAGAAACTAAA
GAAATAGTAAAACAAGAATCAACAAAATAA
back to top