rna3867 (mRNA) Diuraphis noxia
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Cross References
External references for this mRNA
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >rna3867 ID=rna3867|Name=XM_015507860.1|organism=Diuraphis noxia|type=mRNA|length=444bp|location=Sequence derived from alignment at JOTR01000070:691318..691836- (Diuraphis noxia)|Notes=Excludes all bases but those of type(s): exon. ATGTTTTTGATTATTTTTCTTGTTTTTGCGAAATACATTCCATTATACCGback to top protein sequence of XM_015507860.1 >rna3867 ID=rna3867|Name=XM_015507860.1|organism=Diuraphis noxia|type=polypeptide|length=148bp MFLIIFLVFAKYIPLYRLYHVKHCDNSTSNGNTENKTDSSPPIKSPISFLback to top mRNA from alignment at JOTR01000070:691318..691836- Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>rna3867 ID=rna3867|Name=XM_015507860.1|organism=Diuraphis noxia|type=mRNA|length=519bp|location=Sequence derived from alignment at JOTR01000070:691318..691836- (Diuraphis noxia)back to top Coding sequence (CDS) from alignment at JOTR01000070:691318..691836- >rna3867 ID=rna3867|Name=XM_015507860.1|organism=Diuraphis noxia|type=CDS|length=444bp|location=Sequence derived from alignment at JOTR01000070:691318..691836- (Diuraphis noxia)back to top Metabolic Data
View metabolic data for rna3867 on AphidCyc
|