rna3632 (polypeptide) Diuraphis noxia

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameXM_015507624.1
Unique Namerna3632
Typepolypeptide
OrganismDiuraphis noxia (Russian wheat aphid)
Sequence length194
Homology
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|985391704|ref|XP_015363108.1| (PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial isoform X1 [Diuraphis noxia])

HSP 1 Score: 406.757 bits (1044), Expect = 1.107e-143
Identity = 193/193 (100.00%), Postives = 193/193 (100.00%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:    8 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 200          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|985391706|ref|XP_015363109.1| (PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial isoform X2 [Diuraphis noxia] >gi|985391708|ref|XP_015363110.1| PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial isoform X2 [Diuraphis noxia] >gi|985391710|ref|XP_015363111.1| PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial isoform X2 [Diuraphis noxia])

HSP 1 Score: 405.986 bits (1042), Expect = 2.189e-143
Identity = 193/193 (100.00%), Postives = 193/193 (100.00%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|1229890855|ref|XP_022165845.1| (5-demethoxyubiquinone hydroxylase, mitochondrial isoform X3 [Myzus persicae])

HSP 1 Score: 386.341 bits (991), Expect = 1.608e-135
Identity = 182/193 (94.30%), Postives = 188/193 (97.41%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMV+QKMTFS I F+RGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEK HR KFEQLINQNRVRPSLLFPLW+CAGYVLGAGTALMGPKAAMACTVAVET+IVEHYNDQLR LMDDP+SDKELLETIKKFRDEEQEHHDCG+DHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:    7 MKMVVQKMTFSSITFRRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKVHRQKFEQLINQNRVRPSLLFPLWHCAGYVLGAGTALMGPKAAMACTVAVETIIVEHYNDQLRELMDDPESDKELLETIKKFRDEEQEHHDCGIDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 199          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|1229890857|ref|XP_022165846.1| (5-demethoxyubiquinone hydroxylase, mitochondrial isoform X4 [Myzus persicae] >gi|1229890859|ref|XP_022165847.1| 5-demethoxyubiquinone hydroxylase, mitochondrial isoform X4 [Myzus persicae])

HSP 1 Score: 385.571 bits (989), Expect = 1.970e-135
Identity = 182/193 (94.30%), Postives = 188/193 (97.41%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMV+QKMTFS I F+RGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEK HR KFEQLINQNRVRPSLLFPLW+CAGYVLGAGTALMGPKAAMACTVAVET+IVEHYNDQLR LMDDP+SDKELLETIKKFRDEEQEHHDCG+DHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:    1 MKMVVQKMTFSSITFRRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKVHRQKFEQLINQNRVRPSLLFPLWHCAGYVLGAGTALMGPKAAMACTVAVETIIVEHYNDQLRELMDDPESDKELLETIKKFRDEEQEHHDCGIDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|1229890851|ref|XP_022165843.1| (5-demethoxyubiquinone hydroxylase, mitochondrial isoform X1 [Myzus persicae])

HSP 1 Score: 390.578 bits (1002), Expect = 1.977e-135
Identity = 182/193 (94.30%), Postives = 188/193 (97.41%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMV+QKMTFS I F+RGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEK HR KFEQLINQNRVRPSLLFPLW+CAGYVLGAGTALMGPKAAMACTVAVET+IVEHYNDQLR LMDDP+SDKELLETIKKFRDEEQEHHDCG+DHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:  125 MKMVVQKMTFSSITFRRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKVHRQKFEQLINQNRVRPSLLFPLWHCAGYVLGAGTALMGPKAAMACTVAVETIIVEHYNDQLRELMDDPESDKELLETIKKFRDEEQEHHDCGIDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 317          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|1229890853|ref|XP_022165844.1| (5-demethoxyubiquinone hydroxylase, mitochondrial isoform X2 [Myzus persicae])

HSP 1 Score: 386.341 bits (991), Expect = 2.031e-135
Identity = 182/193 (94.30%), Postives = 188/193 (97.41%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMV+QKMTFS I F+RGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEK HR KFEQLINQNRVRPSLLFPLW+CAGYVLGAGTALMGPKAAMACTVAVET+IVEHYNDQLR LMDDP+SDKELLETIKKFRDEEQEHHDCG+DHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:   12 MKMVVQKMTFSSITFRRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKVHRQKFEQLINQNRVRPSLLFPLWHCAGYVLGAGTALMGPKAAMACTVAVETIIVEHYNDQLRELMDDPESDKELLETIKKFRDEEQEHHDCGIDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 204          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|242247577|ref|NP_001156131.1| (ubiquinone biosynthesis protein COQ7 homolog [Acyrthosiphon pisum] >gi|641651952|ref|XP_008178191.1| PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X1 [Acyrthosiphon pisum] >gi|1028674303|ref|XP_016656030.1| PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X1 [Acyrthosiphon pisum] >gi|239788411|dbj|BAH70889.1| ACYPI003157 [Acyrthosiphon pisum])

HSP 1 Score: 383.259 bits (983), Expect = 2.017e-134
Identity = 183/193 (94.82%), Postives = 188/193 (97.41%), Query Frame = 0
Query:    1 MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            MKMV+QK TFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEK HR+KFEQLI QNRVRPSLLFPLW+CAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLR LM+DP SDKELLETIKKFRDEEQEHHDCG+DHGAEQAPFYDALTKVIKTGCKVAIEVAKRV
Sbjct:    1 MKMVVQKNTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKVHRHKFEQLIIQNRVRPSLLFPLWHCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRDLMNDPDSDKELLETIKKFRDEEQEHHDCGIDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|1233170898|ref|XP_022187252.1| (5-demethoxyubiquinone hydroxylase, mitochondrial [Nilaparvata lugens] >gi|1233170901|ref|XP_022187253.1| 5-demethoxyubiquinone hydroxylase, mitochondrial [Nilaparvata lugens])

HSP 1 Score: 285.419 bits (729), Expect = 7.026e-96
Identity = 132/184 (71.74%), Postives = 163/184 (88.59%), Query Frame = 0
Query:   10 FSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            FS+ I +R L  ++K++ S+IRVNHAGELGADRIYAGQMAVLG++ VGPKI+EMW+QEKAH+ KFE+LI++ RVRP+++ PLW  AG+VLGAGTAL+G KAAMACTVAVE+VIVEHYNDQLR LMDDP+ +KELL+ I+KFRD+EQEHHD G+DHGAEQAPFY ALT+VIK GCK AI V+K++
Sbjct:    2 FSQQI-RRRLSQSSKEISSMIRVNHAGELGADRIYAGQMAVLGSTPVGPKIQEMWDQEKAHKAKFEELISKYRVRPTVMVPLWNVAGFVLGAGTALLGSKAAMACTVAVESVIVEHYNDQLRVLMDDPEKNKELLQVIQKFRDDEQEHHDTGLDHGAEQAPFYKALTEVIKIGCKAAITVSKQI 184          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|998519280|ref|XP_015520567.1| (PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial [Neodiprion lecontei] >gi|998519282|ref|XP_015520568.1| PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial [Neodiprion lecontei])

HSP 1 Score: 276.944 bits (707), Expect = 2.343e-92
Identity = 129/174 (74.14%), Postives = 150/174 (86.21%), Query Frame = 0
Query:   22 ANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMD--DPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            A K LD++IRV+HAGELGADRIYAGQMAVLG +SVGP I+ MW+QEK HR KFE+LI ++RVRP++L PLW  AG+VLGAGTA+MGPKAAMACTVAVETVIVEHYN+QLR LM+  D   DKELL+TI+KFRDEEQEHHD G+DHGAEQAPFY ALT VIK GCK AI ++K +
Sbjct:   22 AGKLLDAIIRVDHAGELGADRIYAGQMAVLGKTSVGPTIQHMWDQEKGHREKFEELIRKHRVRPTVLVPLWNVAGFVLGAGTAMMGPKAAMACTVAVETVIVEHYNEQLRSLMENSDENVDKELLDTIRKFRDEEQEHHDTGIDHGAEQAPFYKALTNVIKAGCKTAITISKVI 195          
BLAST of XM_015507624.1 vs. GenBank_protein
Match: gi|1101367007|ref|XP_018914762.1| (PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial [Bemisia tabaci] >gi|1101367009|ref|XP_018914763.1| PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial [Bemisia tabaci] >gi|1101367011|ref|XP_018914764.1| PREDICTED: 5-demethoxyubiquinone hydroxylase, mitochondrial [Bemisia tabaci])

HSP 1 Score: 275.404 bits (703), Expect = 1.073e-91
Identity = 124/189 (65.61%), Postives = 154/189 (81.48%), Query Frame = 0
Query:    5 LQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKFRDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV 193
            +      +++ +R  H  +K++DS+IRV+HAGE GADRIYAGQ+AVLGNS VGPKI EMWEQEK H+ KF++LIN+ RVRP+ L PLW  AG+ LGAG+AL+GPKAAMACTVAVE+VIVEHYNDQLR LM DP+ +KELLE IKKFRD+EQEHHD G++HGAE+APFY   + VIK GCK AI ++K +
Sbjct:    6 IPSQVLPKVVGRRFQHRVSKEVDSIIRVDHAGEFGADRIYAGQIAVLGNSVVGPKIAEMWEQEKVHKAKFDELINKYRVRPTALLPLWNIAGFALGAGSALLGPKAAMACTVAVESVIVEHYNDQLRTLMSDPEKNKELLEVIKKFRDDEQEHHDTGLEHGAEEAPFYRLFSDVIKLGCKTAISISKVI 194          
The following BLAST results are available for this feature:
BLAST of XM_015507624.1 vs. GenBank_protein
Analysis Date: 2018-05-22 (Blastp: NCBI Gnomon 20160302 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|985391704|ref|XP_015363108.1|1.107e-143100.00PREDICTED: 5-demethoxyubiquinone hydroxylase, mito... [more]
gi|985391706|ref|XP_015363109.1|2.189e-143100.00PREDICTED: 5-demethoxyubiquinone hydroxylase, mito... [more]
gi|1229890855|ref|XP_022165845.1|1.608e-13594.305-demethoxyubiquinone hydroxylase, mitochondrial i... [more]
gi|1229890857|ref|XP_022165846.1|1.970e-13594.305-demethoxyubiquinone hydroxylase, mitochondrial i... [more]
gi|1229890851|ref|XP_022165843.1|1.977e-13594.305-demethoxyubiquinone hydroxylase, mitochondrial i... [more]
gi|1229890853|ref|XP_022165844.1|2.031e-13594.305-demethoxyubiquinone hydroxylase, mitochondrial i... [more]
gi|242247577|ref|NP_001156131.1|2.017e-13494.82ubiquinone biosynthesis protein COQ7 homolog [Acyr... [more]
gi|1233170898|ref|XP_022187252.1|7.026e-9671.745-demethoxyubiquinone hydroxylase, mitochondrial [... [more]
gi|998519280|ref|XP_015520567.1|2.343e-9274.14PREDICTED: 5-demethoxyubiquinone hydroxylase, mito... [more]
gi|1101367007|ref|XP_018914762.1|1.073e-9165.61PREDICTED: 5-demethoxyubiquinone hydroxylase, mito... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006744 ubiquinone biosynthetic process
cellular_component GO:0031314 extrinsic component of mitochondrial inner membrane
molecular_function GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
InterPro
Analysis Name: InterProScan on NCBI Gnomon 20160302
Date Performed: 2018-05-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011566Ubiquinone biosynthesis protein Coq7PFAMPF03232COQ7coord: 26..193
e-value: 2.2E-75
score: 252.0
IPR011566Ubiquinone biosynthesis protein Coq7PANTHERPTHR11237COENZYME Q10 BIOSYNTHESIS PROTEIN 7coord: 23..193
IPR011566Ubiquinone biosynthesis protein Coq7HAMAPMF_01658COQ7coord: 4..193
score: 30.933
IPR011566Ubiquinone biosynthesis protein Coq7CDDcd01042DMQHcoord: 26..192
e-value: 8.86916E-88
score: 253.218
NoneNo IPR availablePANTHERPTHR11237:SF45-DEMETHOXYUBIQUINONE HYDROXYLASE, MITOCHONDRIALcoord: 23..193
IPR009078Ferritin-like superfamilySUPERFAMILY47240Ferritin-likecoord: 25..161

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:126193..126909 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on NCBI Gnomon 201603022018-05-22
Blastp: NCBI Gnomon 20160302 vs NR2018-05-22
Blast2GO on NCBI Gnomon (20160302)2018-05-22
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
XM_015507624.1rna3632Diuraphis noxiamRNAJOTR01000065 123522..127002 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>rna3632 ID=rna3632|Name=XM_015507624.1|organism=Diuraphis noxia|type=polypeptide|length=194bp
MKMVLQKMTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAV
LGNSSVGPKIKEMWEQEKAHRYKFEQLINQNRVRPSLLFPLWYCAGYVLG
AGTALMGPKAAMACTVAVETVIVEHYNDQLRHLMDDPKSDKELLETIKKF
RDEEQEHHDCGMDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0031314extrinsic component of mitochondrial inner membrane
Vocabulary: Molecular Function
TermDefinition
GO:0016709oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
Vocabulary: Biological Process
TermDefinition
GO:0006744ubiquinone biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR011566Ubq_synth_Coq7
IPR009078Ferritin-like_SF