rna3634 (polypeptide) Diuraphis noxia

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameXM_015507626.1
Unique Namerna3634
Typepolypeptide
OrganismDiuraphis noxia (Russian wheat aphid)
Sequence length181
Homology
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|1229890849|ref|XP_022165842.1| (protein shifted [Myzus persicae])

HSP 1 Score: 374.015 bits (959), Expect = 6.534e-128
Identity = 178/180 (98.89%), Postives = 178/180 (98.89%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH 180
            MGQYCKTALCYPQCMNNGTCVAPGVCRCP GFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPC HGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH
Sbjct:  218 MGQYCKTALCYPQCMNNGTCVAPGVCRCPLGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCRHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH 397          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|985391712|ref|XP_015363112.1| (PREDICTED: protein shifted [Diuraphis noxia])

HSP 1 Score: 365.54 bits (937), Expect = 7.994e-128
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH 180
            MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH
Sbjct:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH 180          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|328700417|ref|XP_003241249.1| (PREDICTED: protein shifted [Acyrthosiphon pisum])

HSP 1 Score: 371.703 bits (953), Expect = 3.962e-127
Identity = 177/180 (98.33%), Postives = 178/180 (98.89%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDDDDMDDYDEVPKSHHRWH 180
            MGQYCKTALCYPQCMNNGTCVAPGVCRCP GFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPC HGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRS+YPHSCEDDDDDMDDYDEVPKSHHRWH
Sbjct:  215 MGQYCKTALCYPQCMNNGTCVAPGVCRCPQGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCRHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSDYPHSCEDDDDDMDDYDEVPKSHHRWH 394          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|501298202|dbj|BAN21300.1| (conserved hypothetical protein [Riptortus pedestris])

HSP 1 Score: 230.335 bits (586), Expect = 8.003e-72
Identity = 111/160 (69.38%), Postives = 128/160 (80.00%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCE 160
            MGQYCKTALCYPQC+NNGTC APG C CPPGFQG HCEGGIC++KC NGGKCIQKDTC+CPKG+YGLRCE+SKCIIPC+NGG+CKG+NKCRC  GF+GDHCEIG+ + Q   C +PC HG CT+N  C C QGW GKFCQ K+ K   + +  E   S E
Sbjct:  203 MGQYCKTALCYPQCVNNGTCTAPGTCTCPPGFQGRHCEGGICSKKCENGGKCIQKDTCECPKGYYGLRCEFSKCIIPCVNGGRCKGINKCRCPNGFRGDHCEIGRRVPQRSTCSKPCKHGICTSNNTCLCDQGWSGKFCQHKVQKLDPELYYPEETSSEE 362          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|939652422|ref|XP_014275159.1| (PREDICTED: protein shifted-like [Halyomorpha halys])

HSP 1 Score: 221.476 bits (563), Expect = 2.140e-68
Identity = 111/163 (68.10%), Postives = 124/163 (76.07%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDNHRSEYPHSCEDDD 163
            MGQYCKTALCYPQC+NNGTC APG C CPPGFQG HCEGGIC+EKC NGGKCIQKDTC+C KG+YGLRCE+SKCIIPCLNGG+CKG+NKCRC  GF+GDHCEIG+       C RPC HG C  N  C C QGW GK CQ KI K    ++  E   S E ++
Sbjct:  204 MGQYCKTALCYPQCVNNGTCTAPGTCTCPPGFQGRHCEGGICSEKCQNGGKCIQKDTCECSKGYYGLRCEFSKCIIPCLNGGRCKGINKCRCPNGFRGDHCEIGRRSPAKSPCSRPCKHGVCFYNNTCLCDQGWSGKSCQHKIQKLDTQSYFPEEQSSEEFNN 366          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|1227963156|ref|XP_021912857.1| (protein shifted isoform X3 [Zootermopsis nevadensis] >gi|1227963158|ref|XP_021912858.1| protein shifted isoform X3 [Zootermopsis nevadensis])

HSP 1 Score: 213.386 bits (542), Expect = 2.685e-65
Identity = 102/143 (71.33%), Postives = 116/143 (81.12%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKI 143
            MGQYCKTALCYPQCMN G+C APGVC C  GFQG HCEGGICAEKCLNGGKCIQKDTC+C KG+YGLRCE+SKCIIPCLNGG+C+GVNKCRC  GF+GDHCEIG+ +     C +PC HG C  +  C C  GW+GK C +K+
Sbjct:  205 MGQYCKTALCYPQCMNGGSCTAPGVCSCVIGFQGRHCEGGICAEKCLNGGKCIQKDTCECSKGYYGLRCEFSKCIIPCLNGGRCRGVNKCRCPNGFKGDHCEIGRRVPARSLCTKPCRHGTCRPDNTCLCDPGWYGKLCHQKV 347          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|1227963154|ref|XP_021912855.1| (protein shifted isoform X2 [Zootermopsis nevadensis] >gi|646721464|gb|KDR22793.1| Protein shifted [Zootermopsis nevadensis])

HSP 1 Score: 213.386 bits (542), Expect = 2.996e-65
Identity = 102/143 (71.33%), Postives = 116/143 (81.12%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKI 143
            MGQYCKTALCYPQCMN G+C APGVC C  GFQG HCEGGICAEKCLNGGKCIQKDTC+C KG+YGLRCE+SKCIIPCLNGG+C+GVNKCRC  GF+GDHCEIG+ +     C +PC HG C  +  C C  GW+GK C +K+
Sbjct:  207 MGQYCKTALCYPQCMNGGSCTAPGVCSCVIGFQGRHCEGGICAEKCLNGGKCIQKDTCECSKGYYGLRCEFSKCIIPCLNGGRCRGVNKCRCPNGFKGDHCEIGRRVPARSLCTKPCRHGTCRPDNTCLCDPGWYGKLCHQKV 349          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|1227963152|ref|XP_021912854.1| (protein shifted isoform X1 [Zootermopsis nevadensis])

HSP 1 Score: 213.772 bits (543), Expect = 3.357e-65
Identity = 102/143 (71.33%), Postives = 116/143 (81.12%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKI 143
            MGQYCKTALCYPQCMN G+C APGVC C  GFQG HCEGGICAEKCLNGGKCIQKDTC+C KG+YGLRCE+SKCIIPCLNGG+C+GVNKCRC  GF+GDHCEIG+ +     C +PC HG C  +  C C  GW+GK C +K+
Sbjct:  225 MGQYCKTALCYPQCMNGGSCTAPGVCSCVIGFQGRHCEGGICAEKCLNGGKCIQKDTCECSKGYYGLRCEFSKCIIPCLNGGRCRGVNKCRCPNGFKGDHCEIGRRVPARSLCTKPCRHGTCRPDNTCLCDPGWYGKLCHQKV 367          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|1339089351|ref|XP_023705810.1| (protein shifted isoform X2 [Cryptotermes secundus])

HSP 1 Score: 209.534 bits (532), Expect = 1.907e-64
Identity = 100/142 (70.42%), Postives = 114/142 (80.28%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRK 142
            MGQYCKTALCYPQCMN G+C APG+C CP GFQG HCEGGICAEKC NGGKCIQKDTC+C KG+YGLRCE+SKCIIPCLNGG+C+GVNKCRC  G+ GDHCEIG+ +     C +PC HG C  +  C C  GW+GK C +K
Sbjct:  155 MGQYCKTALCYPQCMNGGSCTAPGMCSCPIGFQGRHCEGGICAEKCQNGGKCIQKDTCECSKGYYGLRCEFSKCIIPCLNGGRCRGVNKCRCPTGYMGDHCEIGRHVPARSTCTKPCRHGTCRPDNTCVCDPGWYGKLCHQK 296          
BLAST of XM_015507626.1 vs. GenBank_protein
Match: gi|1339089349|ref|XP_023705809.1| (protein shifted isoform X1 [Cryptotermes secundus])

HSP 1 Score: 210.69 bits (535), Expect = 2.639e-64
Identity = 100/142 (70.42%), Postives = 114/142 (80.28%), Query Frame = 0
Query:    1 MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGGKCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDHCEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRK 142
            MGQYCKTALCYPQCMN G+C APG+C CP GFQG HCEGGICAEKC NGGKCIQKDTC+C KG+YGLRCE+SKCIIPCLNGG+C+GVNKCRC  G+ GDHCEIG+ +     C +PC HG C  +  C C  GW+GK C +K
Sbjct:  205 MGQYCKTALCYPQCMNGGSCTAPGMCSCPIGFQGRHCEGGICAEKCQNGGKCIQKDTCECSKGYYGLRCEFSKCIIPCLNGGRCRGVNKCRCPTGYMGDHCEIGRHVPARSTCTKPCRHGTCRPDNTCVCDPGWYGKLCHQK 346          
The following BLAST results are available for this feature:
BLAST of XM_015507626.1 vs. GenBank_protein
Analysis Date: 2018-05-22 (Blastp: NCBI Gnomon 20160302 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1229890849|ref|XP_022165842.1|6.534e-12898.89protein shifted [Myzus persicae][more]
gi|985391712|ref|XP_015363112.1|7.994e-128100.00PREDICTED: protein shifted [Diuraphis noxia][more]
gi|328700417|ref|XP_003241249.1|3.962e-12798.33PREDICTED: protein shifted [Acyrthosiphon pisum][more]
gi|501298202|dbj|BAN21300.1|8.003e-7269.38conserved hypothetical protein [Riptortus pedestri... [more]
gi|939652422|ref|XP_014275159.1|2.140e-6868.10PREDICTED: protein shifted-like [Halyomorpha halys... [more]
gi|1227963156|ref|XP_021912857.1|2.685e-6571.33protein shifted isoform X3 [Zootermopsis nevadensi... [more]
gi|1227963154|ref|XP_021912855.1|2.996e-6571.33protein shifted isoform X2 [Zootermopsis nevadensi... [more]
gi|1227963152|ref|XP_021912854.1|3.357e-6571.33protein shifted isoform X1 [Zootermopsis nevadensi... [more]
gi|1339089351|ref|XP_023705810.1|1.907e-6470.42protein shifted isoform X2 [Cryptotermes secundus][more]
gi|1339089349|ref|XP_023705809.1|2.639e-6470.42protein shifted isoform X1 [Cryptotermes secundus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
InterPro
Analysis Name: InterProScan on NCBI Gnomon 20160302
Date Performed: 2018-05-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 73..102
e-value: 0.23
score: 20.6
coord: 41..70
e-value: 3.5E-4
score: 29.9
coord: 112..140
e-value: 0.022
score: 23.9
coord: 9..38
e-value: 8.6E-4
score: 28.6
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 6..36
score: 6.941
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 71..102
score: 11.333
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 38..70
score: 15.58
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 109..140
score: 8.66
NoneNo IPR availableGENE3D2.10.25.10coord: 1..40
e-value: 1.0E-10
score: 43.5
NoneNo IPR availableGENE3D2.10.25.10coord: 76..104
e-value: 3.6E-7
score: 31.9
coord: 42..75
e-value: 2.9E-10
score: 41.7
NoneNo IPR availableGENE3D2.10.25.10coord: 105..142
e-value: 7.6E-8
score: 34.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..180
NoneNo IPR availablePANTHERPTHR44602FAMILY NOT NAMEDcoord: 2..145
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 10..40
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 72..113
NoneNo IPR availableSUPERFAMILY57196EGF/Laminincoord: 42..73
IPR013032EGF-like, conserved sitePFAMPF12661hEGFcoord: 46..64
e-value: 0.0086
score: 16.6
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 128..139
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 128..139
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 90..101
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 58..69
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 58..69
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 90..101
IPR013111EGF-like domain, extracellularPFAMPF07974EGF_2coord: 5..37
e-value: 6.9E-6
score: 26.2

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:125170..127146 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on NCBI Gnomon 201603022018-05-22
Blastp: NCBI Gnomon 20160302 vs NR2018-05-22
Blast2GO on NCBI Gnomon (20160302)2018-05-22
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
XM_015507626.1rna3634Diuraphis noxiamRNAJOTR01000065 125021..127295 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>rna3634 ID=rna3634|Name=XM_015507626.1|organism=Diuraphis noxia|type=polypeptide|length=181bp
MGQYCKTALCYPQCMNNGTCVAPGVCRCPPGFQGPHCEGGICAEKCLNGG
KCIQKDTCQCPKGFYGLRCEYSKCIIPCLNGGKCKGVNKCRCIFGFQGDH
CEIGQPIKQYYNCKRPCHHGYCTANRICRCQQGWFGKFCQRKILKPKHDN
HRSEYPHSCEDDDDDMDDYDEVPKSHHRWH.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR013032EGF-like_CS
IPR013111EGF_extracell