rna3663 (polypeptide) Diuraphis noxia

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameXM_015507633.1
Unique Namerna3663
Typepolypeptide
OrganismDiuraphis noxia (Russian wheat aphid)
Sequence length2377
Homology
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|985391724|ref|XP_015363118.1| (PREDICTED: PHD finger protein rhinoceros isoform X1 [Diuraphis noxia] >gi|985391726|ref|XP_015363119.1| PREDICTED: PHD finger protein rhinoceros isoform X1 [Diuraphis noxia])

HSP 1 Score: 4871.22 bits (12634), Expect = 0.000e+0
Identity = 2375/2376 (99.96%), Postives = 2375/2376 (99.96%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHXLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376
            MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSH LIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR
Sbjct:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHBLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|985391728|ref|XP_015363121.1| (PREDICTED: PHD finger protein rhinoceros isoform X2 [Diuraphis noxia])

HSP 1 Score: 4814.6 bits (12487), Expect = 0.000e+0
Identity = 2353/2376 (99.03%), Postives = 2354/2376 (99.07%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHXLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376
            MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDI                     +SVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSH LIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR
Sbjct:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDI---------------------KSVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHBLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2355          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|641658231|ref|XP_008180648.1| (PREDICTED: PHD finger protein rhinoceros isoform X1 [Acyrthosiphon pisum])

HSP 1 Score: 4482.17 bits (11624), Expect = 0.000e+0
Identity = 2256/2378 (94.87%), Postives = 2320/2378 (97.56%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKES-LEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHXLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSA-VTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376
            MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFK+EEHQLSLLPLKAEKSCSYDMDDVD+AWLKLCNGER+LGGFPKIKDDQFE VMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVL+D KLNLSSAEVSA QEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAG GSPEKSNYT LKWP SNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGS+DSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDS+SYTHTKAAVKEFSQGKSK KV+KDKSTSV+K KE+ LEKDTKKIKKDD KNNTTVP+ELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFS+H+KSPERV+SN KSPDKQP KVNKIKN EKLSSVEKESD QDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVS+ VKKDDST KSKRS KSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDR+SP KEI+K+KSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCD+VQI+TCGDSS+GDDGNRKSSDSD+VGTSTSQPDG KQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKK+SK+ FNC+NH+SG QRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPL+FTFNNEFLFKDDSKE+TARETLNLVEKLRLGITKK+VPLENENIENIELNDTPKIL+PPKPSEPEQKTDNILYNAYNKFHQQSN+VVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEH++P TTES+YQNIH+FPTSVPMQ+++MQ+ Q+S+PSF+LNPP++NQLSFMSSSR FNPQQFAIPPPFSAHQ+LMPELNKPLHL QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYN+SNLL+G  TNN S H+ESVMHTVFNAINQASMIDNQLSILPTIQ   TP+VSTSNQ+SG H  IPASTNNQTQEI +QSTSNQHQ+PVTSNNQTEITL+QSISNNQEPVFSQSKI S QVT   QL  PISNQ+PLN QQSIPEVHTP +CQAEVS QNIINQTP+QTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPE+KKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPI ET IEDPPA II+DELTPMLP PVDMRTYDSYDN TSYSDNIY+TNTNVDDKVTDIVNTLKEDL N SKLSSKDKDIEDQL+L+DDQIKI+KLP PVEKEPVASSTVLQS+SRNQLKVKIKGPFLNAKYNN+QNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQP+VTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSI IA V KNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSA VTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR
Sbjct:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKTEEHQLSLLPLKAEKSCSYDMDDVDSAWLKLCNGERSLGGFPKIKDDQFEHVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLSDTKLNLSSAEVSAVQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGAGSPEKSNYTSLKWPSSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSEDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSISYTHTKAAVKEFSQGKSKVKVIKDKSTSVAKPKETLLEKDTKKIKKDDAKNNTTVPSELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSTHKKSPERVTSNIKSPDKQPTKVNKIKNTEKLSSVEKESDPQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSDSVKKDDSTIKSKRSTKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRISPQKEINKSKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDTVQIITCGDSSVGDDGNRKSSDSDHVGTSTSQPDGTKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKFSKLPFNCSNHYSGGQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLTFTFNNEFLFKDDSKEVTARETLNLVEKLRLGITKKSVPLENENIENIELNDTPKILEPPKPSEPEQKTDNILYNAYNKFHQQSNEVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHRDPTTTESVYQNIHTFPTSVPMQMDNMQYSQYSDPSFILNPPTNNQLSFMSSSRTFNPQQFAIPPPFSAHQSLMPELNKPLHL-QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNESNLLVGSGTNNLSTHTESVMHTVFNAINQASMIDNQLSILPTIQ---TPRVSTSNQMSGVHNQIPASTNNQTQEIKVQSTSNQHQIPVTSNNQTEITLAQSISNNQEPVFSQSKITSGQVTSTIQLTTPISNQMPLNNQQSIPEVHTPSICQAEVS-QNIINQTPIQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEIKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPIIETTIEDPPAPIIIDELTPMLPGPVDMRTYDSYDNATSYSDNIYDTNTNVDDKVTDIVNTLKEDLQNLSKLSSKDKDIEDQLVLMDDQIKIVKLPLPVEKEPVASSTVLQSDSRNQLKVKIKGPFLNAKYNNVQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPVVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSISIAPVTKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2373          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|1028690027|ref|XP_016657953.1| (PREDICTED: PHD finger protein rhinoceros isoform X2 [Acyrthosiphon pisum])

HSP 1 Score: 4439.41 bits (11513), Expect = 0.000e+0
Identity = 2241/2378 (94.24%), Postives = 2303/2378 (96.85%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKES-LEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHXLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSA-VTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376
            MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFK+EEHQLSLLPLKAEKSCSYDMDDVD+AWLKLCNGER+LGGFPKIKDDQFE VMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVL+D KLNLSSAEVSA QEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAG GSPEKSNYT LKWP SNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGS+DSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDS+SYTHTKAAVKEFSQGKSK KV+KDKSTSV+K KE+ LEKDTKKIKKDD KNNTTVP+ELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFS+H+KSPERV+SN KSPDKQP KVNKIKN EKLSSVEKESD QDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVS+ VKKDDST KSKRS KSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDR+SP KEI+K+KSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCD+VQI+TCGDSS+GDDGNRKSSDSD+VGTSTSQPDG KQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKK+SK+ FNC+NH+SG QRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPL+FTFNNEFLFKDDSKE+TARETLNLVEKLRLGITKK+VPLENENIENIELNDTPKIL+PPKPSEPEQKTDNILYNAYNKFHQQSN+VVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEH++P TTES+YQNIH+FPTSVPMQ+++MQ+ Q+S+PSF+LNPP++NQLSFMSSSR FNPQQFAIPPPFSAHQ+LMPELNKPLHL QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDI                     +SVMHTVFNAINQASMIDNQLSILPTIQ   TP+VSTSNQ+SG H  IPASTNNQTQEI +QSTSNQHQ+PVTSNNQTEITL+QSISNNQEPVFSQSKI S QVT   QL  PISNQ+PLN QQSIPEVHTP +CQAEVS QNIINQTP+QTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPE+KKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPI ET IEDPPA II+DELTPMLP PVDMRTYDSYDN TSYSDNIY+TNTNVDDKVTDIVNTLKEDL N SKLSSKDKDIEDQL+L+DDQIKI+KLP PVEKEPVASSTVLQS+SRNQLKVKIKGPFLNAKYNN+QNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQP+VTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSI IA V KNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSA VTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR
Sbjct:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKTEEHQLSLLPLKAEKSCSYDMDDVDSAWLKLCNGERSLGGFPKIKDDQFEHVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLSDTKLNLSSAEVSAVQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGAGSPEKSNYTSLKWPSSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSEDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSISYTHTKAAVKEFSQGKSKVKVIKDKSTSVAKPKETLLEKDTKKIKKDDAKNNTTVPSELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSTHKKSPERVTSNIKSPDKQPTKVNKIKNTEKLSSVEKESDPQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSDSVKKDDSTIKSKRSTKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRISPQKEINKSKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDTVQIITCGDSSVGDDGNRKSSDSDHVGTSTSQPDGTKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKFSKLPFNCSNHYSGGQRSIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLTFTFNNEFLFKDDSKEVTARETLNLVEKLRLGITKKSVPLENENIENIELNDTPKILEPPKPSEPEQKTDNILYNAYNKFHQQSNEVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHRDPTTTESVYQNIHTFPTSVPMQMDNMQYSQYSDPSFILNPPTNNQLSFMSSSRTFNPQQFAIPPPFSAHQSLMPELNKPLHL-QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDI---------------------KSVMHTVFNAINQASMIDNQLSILPTIQ---TPRVSTSNQMSGVHNQIPASTNNQTQEIKVQSTSNQHQIPVTSNNQTEITLAQSISNNQEPVFSQSKITSGQVTSTIQLTTPISNQMPLNNQQSIPEVHTPSICQAEVS-QNIINQTPIQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEIKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPIIETTIEDPPAPIIIDELTPMLPGPVDMRTYDSYDNATSYSDNIYDTNTNVDDKVTDIVNTLKEDLQNLSKLSSKDKDIEDQLVLMDDQIKIVKLPLPVEKEPVASSTVLQSDSRNQLKVKIKGPFLNAKYNNVQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPVVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSISIAPVTKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2352          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|1229879311|ref|XP_022183568.1| (PHD finger protein rhinoceros isoform X1 [Myzus persicae] >gi|1229879313|ref|XP_022183569.1| PHD finger protein rhinoceros isoform X1 [Myzus persicae] >gi|1229879315|ref|XP_022183570.1| PHD finger protein rhinoceros isoform X1 [Myzus persicae])

HSP 1 Score: 4393.96 bits (11395), Expect = 0.000e+0
Identity = 2214/2379 (93.06%), Postives = 2294/2379 (96.43%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKES-LEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQC-NKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQT-PKTPKVSTSNQISGSHXLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376
            MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQH+EFKLPKHKYIRITKDEHFK+EEHQLSLLPLKAEKSCSYDMDDVD+AWLKLCNGER+LGGFPKIKDDQFE VMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVD+DGILYIYNYWVLKRRSGNNRPLLLPKSDDGD+LGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVL+D+KLNLSSAEVSA QEANHGPSIYDRLYSYPDAPDLSTDFETMLSRI G GSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELK PRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDK KQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVS KDD+ SYTHTKAAVKEFSQGKSK K +KDKSTSVSK+KE+ LEKD KKIKKDD KNNTTVP+ELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFS+H+KSPERVSSN KSPDKQP K+NKIKN+EKLSSVEKESD QDSFSIVPQRQAAKKAIQGIKSGMTKP+EETKVSE VKKDDSTTKSKRSAKSS  S++SSSSSSSSSS++S+SSSSSSS SS+SESDTEPEKKNKSIDRVSP KE+S+TKSPPK KGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRC++VQIVTCGDSS+GDDGNRKSS+SD+VGTS+SQ DG  QETKQ IHAVEDKE+EKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNL+LPGGHRLNDLKDENLLS+ FLTRQDIERE+VN+ID D KK SK+  NCNNHFSG+ RSIFSPQ C NKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSF FNNEFLFKDDSKEITARETLNLVEKLRLGITKK+VPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSN+VVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEH++P TTESLYQ+IHSFPTSVPMQ++SMQ+ Q+S+PSF+LNPP +NQ+SF+ SSR +NPQQFA+P P+SAHQ+LMPELNKPLHL QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFI P+NDISMYNDSNLL+G STNN  LH++SVMH+VFNAINQA+MIDNQLSILPT+Q+ P++ +VSTS+ ISG H    AST+NQ QEIN+QSTSNQHQVP TSNNQTEITL+QSISNNQEPVFSQSKI S Q T  +QL    SNQI LNKQQSIPEVHTP +CQAEVS QNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPI ET  EDPPAQII  ELTPMLP PVDMRTYDSYDNT +YSDNIYETNTNVDDKVTDIVNT KEDL NFSKLSSKDKDIEDQL+LIDDQIK +KLPPPVE EP+ASS VLQSESRNQLKVKIKGPFLNAKYNN+QNQPILPTIDTSAISMNIPSHS+PPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATV KNKKKRRSSPSVSRKKK RTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVS V EPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR
Sbjct:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHSEFKLPKHKYIRITKDEHFKTEEHQLSLLPLKAEKSCSYDMDDVDSAWLKLCNGERSLGGFPKIKDDQFEHVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDSDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDILGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLSDSKLNLSSAEVSAVQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIGGAGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKAPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKAKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSAKDDNNSYTHTKAAVKEFSQGKSKIKTIKDKSTSVSKSKETLLEKDAKKIKKDDAKNNTTVPSELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSTHKKSPERVSSNIKSPDKQPTKINKIKNSEKLSSVEKESDPQDSFSIVPQRQAAKKAIQGIKSGMTKPIEETKVSESVKKDDSTTKSKRSAKSS-LSSTSSSSSSSSSSSTSSSSSSSSSSSSSSESDTEPEKKNKSIDRVSPQKEVSRTKSPPKTKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCNTVQIVTCGDSSVGDDGNRKSSNSDHVGTSSSQSDGTNQETKQSIHAVEDKEIEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLFLPGGHRLNDLKDENLLSAPFLTRQDIEREMVNHIDCDTKKSSKVMSNCNNHFSGNHRSIFSPQPCGNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFAFNNEFLFKDDSKEITARETLNLVEKLRLGITKKSVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNEVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHRDPTTTESLYQSIHSFPTSVPMQMDSMQYSQYSDPSFILNPPPNNQVSFIPSSRTYNPQQFAVPTPYSAHQSLMPELNKPLHL-QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIQPYNDISMYNDSNLLIGSSTNNLFLHTDSVMHSVFNAINQATMIDNQLSILPTLQSPPRSSRVSTSHHISGGHNQTQASTSNQIQEINVQSTSNQHQVPETSNNQTEITLAQSISNNQEPVFSQSKITSGQATSTSQLTTQTSNQIQLNKQQSIPEVHTPSICQAEVS-QNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPIIETTNEDPPAQIIKVELTPMLPGPVDMRTYDSYDNTPTYSDNIYETNTNVDDKVTDIVNTFKEDLQNFSKLSSKDKDIEDQLVLIDDQIKTVKLPPPVEIEPIASSAVLQSESRNQLKVKIKGPFLNAKYNNVQNQPILPTIDTSAISMNIPSHSIPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVTKNKKKRRSSPSVSRKKKQRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSPVREPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|1229879317|ref|XP_022183571.1| (PHD finger protein rhinoceros isoform X2 [Myzus persicae])

HSP 1 Score: 4351.2 bits (11284), Expect = 0.000e+0
Identity = 2198/2379 (92.39%), Postives = 2276/2379 (95.67%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTSVSKTKES-LEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDSTTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEKKNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSSIGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRLNDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQRSIFSPQQC-NKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHQNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFMSSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTVFNAINQASMIDNQLSILPTIQT-PKTPKVSTSNQISGSHXLIPASTNNQTQEINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPKNQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2376
            MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQH+EFKLPKHKYIRITKDEHFK+EEHQLSLLPLKAEKSCSYDMDDVD+AWLKLCNGER+LGGFPKIKDDQFE VMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVD+DGILYIYNYWVLKRRSGNNRPLLLPKSDDGD+LGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVL+D+KLNLSSAEVSA QEANHGPSIYDRLYSYPDAPDLSTDFETMLSRI G GSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELK PRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDK KQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVS KDD+ SYTHTKAAVKEFSQGKSK K +KDKSTSVSK+KE+ LEKD KKIKKDD KNNTTVP+ELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFS+H+KSPERVSSN KSPDKQP K+NKIKN+EKLSSVEKESD QDSFSIVPQRQAAKKAIQGIKSGMTKP+EETKVSE VKKDDSTTKSKRSAKSS  S++SSSSSSSSSS++S+SSSSSSS SS+SESDTEPEKKNKSIDRVSP KE+S+TKSPPK KGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRC++VQIVTCGDSS+GDDGNRKSS+SD+VGTS+SQ DG  QETKQ IHAVEDKE+EKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNL+LPGGHRLNDLKDENLLS+ FLTRQDIERE+VN+ID D KK SK+  NCNNHFSG+ RSIFSPQ C NKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSF FNNEFLFKDDSKEITARETLNLVEKLRLGITKK+VPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSN+VVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEH++P TTESLYQ+IHSFPTSVPMQ++SMQ+ Q+S+PSF+LNPP +NQ+SF+ SSR +NPQQFA+P P+SAHQ+LMPELNKPLHL QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFI P+NDI+                     SVMH+VFNAINQA+MIDNQLSILPT+Q+ P++ +VSTS+ ISG H    AST+NQ QEIN+QSTSNQHQVP TSNNQTEITL+QSISNNQEPVFSQSKI S Q T  +QL    SNQI LNKQQSIPEVHTP +CQAEVS QNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPI ET  EDPPAQII  ELTPMLP PVDMRTYDSYDNT +YSDNIYETNTNVDDKVTDIVNT KEDL NFSKLSSKDKDIEDQL+LIDDQIK +KLPPPVE EP+ASS VLQSESRNQLKVKIKGPFLNAKYNN+QNQPILPTIDTSAISMNIPSHS+PPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATV KNKKKRRSSPSVSRKKK RTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVS V EPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR
Sbjct:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHSEFKLPKHKYIRITKDEHFKTEEHQLSLLPLKAEKSCSYDMDDVDSAWLKLCNGERSLGGFPKIKDDQFEHVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDSDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDILGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLSDSKLNLSSAEVSAVQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIGGAGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSSMSSSSDLELKAPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKAKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKRPTKVNNIYSDSDSEVSAKDDNNSYTHTKAAVKEFSQGKSKIKTIKDKSTSVSKSKETLLEKDAKKIKKDDAKNNTTVPSELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSTHKKSPERVSSNIKSPDKQPTKINKIKNSEKLSSVEKESDPQDSFSIVPQRQAAKKAIQGIKSGMTKPIEETKVSESVKKDDSTTKSKRSAKSS-LSSTSSSSSSSSSSSTSSSSSSSSSSSSSSESDTEPEKKNKSIDRVSPQKEVSRTKSPPKTKGWLSENKPIKISSSSSSESDKDQKVIRAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCNTVQIVTCGDSSVGDDGNRKSSNSDHVGTSSSQSDGTNQETKQSIHAVEDKEIEKKLKLDDGDQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLFLPGGHRLNDLKDENLLSAPFLTRQDIEREMVNHIDCDTKKSSKVMSNCNNHFSGNHRSIFSPQPCGNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFAFNNEFLFKDDSKEITARETLNLVEKLRLGITKKSVPLENENIENIELNDTPKILDPPKPSEPEQKTDNILYNAYNKFHQQSNEVVDVNKVPERDKLDRSESALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEHRDPTTTESLYQSIHSFPTSVPMQMDSMQYSQYSDPSFILNPPPNNQVSFIPSSRTYNPQQFAVPTPYSAHQSLMPELNKPLHL-QTPCTAAFTSSTQNMAFTAAMISPMTHHDNFIQPYNDIN---------------------SVMHSVFNAINQATMIDNQLSILPTLQSPPRSSRVSTSHHISGGHNQTQASTSNQIQEINVQSTSNQHQVPETSNNQTEITLAQSISNNQEPVFSQSKITSGQATSTSQLTTQTSNQIQLNKQQSIPEVHTPSICQAEVS-QNIINQTPVQTPISVSQVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPIIETTNEDPPAQIIKVELTPMLPGPVDMRTYDSYDNTPTYSDNIYETNTNVDDKVTDIVNTFKEDLQNFSKLSSKDKDIEDQLVLIDDQIKTVKLPPPVEIEPIASSAVLQSESRNQLKVKIKGPFLNAKYNNVQNQPILPTIDTSAISMNIPSHSIPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPKIKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVTKNKKKRRSSPSVSRKKKQRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSPVREPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNNNCEVR 2355          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|939233711|ref|XP_014241583.1| (PREDICTED: PHD finger protein rhinoceros [Cimex lectularius] >gi|939233713|ref|XP_014241592.1| PREDICTED: PHD finger protein rhinoceros [Cimex lectularius])

HSP 1 Score: 1073.92 bits (2776), Expect = 0.000e+0
Identity = 578/989 (58.44%), Postives = 702/989 (70.98%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSP-----EKSNYTGLKWPQSNNPYKRSYINGSIR-----YSSMSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQF----GSDDSEDVSLPKLSSKRPTK-VNNIYSDSDSEVSTKDD-SLSYTHTKAAVKEFS--------QGKSKTKVLKDKSTSVSKTKESL-EKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSS-----------------VEKESDL---QDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEP 944
            MS R KRQ    D+  + +KRRK R   + EEEEAS         SD+KI SSIYN R +++APAELFRKDLISAMKLPDSE LS D YW+I+DQWKQEWE+GVQVPVNPDSLPGSSV     V  Q+        PSS  H   +EFKLPK KYI+ITK E+FKS+EH LS +P KAEK CSYD+D+ D AWLK+ NGER   G P I++DQ ERV+EELE+RCW+KVQTI+K EEGLGIEYDENVICDVCRSPDSE+ NEMVFCD+CNICVHQACYGITTIPSGSWLCRTC +  RPECVLCPNK GAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIP SRWALICVLCRERVGACIQCSVKTCK AYHVTCAFKHGLEM+AIIE+E+AEDGVKLRSYC+KHSV  K    S SED++  ++KRKDMTSEEKNQARAAKLQEIEG+FEKHVS  +V+   DVD +G++YIYNYWVLKRRS  N+PLL P+SDD D L RQQEQADLEK +MFVQLR+DLERVRNLCYMVSRREKLSR    +REQTFHKQ+AVL++   +LSSAE++A +EANHGPSIYD+LYS+  A +LSTDFET L+RIAG  SP      K +  G++  +  NPYKR Y+NG +      Y+SMSS S++++K P  +  +  S D+ +     L KR +           ++++ D+STE+E +K K  W    +K L Q+EK+     G+DDS+D+ +P  + K+ ++  +NIYSDSDS+ S KD+ +     TKAA+KEF+          K      K+++   S   E   +K+   + K   K+ T   T+LIVPQRQAAKKATESI   H K  E          L  S +++ + +SSN +S   +P K  K+K +++LS                   E + DL   QD  + VPQRQAAKKA + IKSG+ KPV   + S+P
Sbjct:    1 MSQRGKRQTSRLDDGLVTSKRRKVRCMAMAEEEEASVDIWTPRPNSDLKI-SSIYN-RSSSEAPAELFRKDLISAMKLPDSEPLSADEYWVITDQWKQEWEKGVQVPVNPDSLPGSSV----TVVTQAF-------PSSRLH---HEFKLPKSKYIKITKCENFKSDEHFLSPIPCKAEKVCSYDLDNCDNAWLKIANGERATMGLPPIREDQLERVIEELELRCWDKVQTILKSEEGLGIEYDENVICDVCRSPDSEESNEMVFCDSCNICVHQACYGITTIPSGSWLCRTCAIGQRPECVLCPNKGGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICVLCRERVGACIQCSVKTCKVAYHVTCAFKHGLEMKAIIENENAEDGVKLRSYCEKHSVAKKDQSGSTSEDDECKRKKRKDMTSEEKNQARAAKLQEIEGKFEKHVSAHEVSGHHDVDLEGLVYIYNYWVLKRRSNCNKPLLAPRSDDVDFLTRQQEQADLEKMRMFVQLRRDLERVRNLCYMVSRREKLSRTFFRMREQTFHKQIAVLSEPSCSLSSAEITAVKEANHGPSIYDKLYSHTAASELSTDFETALARIAGVSSPTLEDKNKIDRNGMR-KKPENPYKRMYVNGGLERRRSVYTSMSSGSEMDIKRP--LRLDLDSTDDKKNKSKKLKKRPI-----------SRITVDTSTEDE-EKPKVPWASPRSKSLRQMEKELAERTGTDDSDDL-IPFTNVKKDSRSASNIYSDSDSDTSLKDERNEQRLRTKAALKEFTALAHKNKKSNKKSPSKNKERNIDSSMEDEYYRDKENVNLSKQKSKDPT---TDLIVPQRQAAKKATESIRSTHVKKSE----------LILSEQEAIKTMSSNEESKLSKPNKSVKLKGSKELSVKENKLLMDDKSKLSNDIYEFDKDLCSDQDILAYVPQRQAAKKAAEHIKSGLHKPVSNEQESDP 944          

HSP 2 Score: 243.432 bits (620), Expect = 1.784e-60
Identity = 243/667 (36.43%), Postives = 342/667 (51.27%), Query Frame = 0
Query: 1802 KKSPSKPTRSSSRVTAQSYKSP---------EIVDHSPEVKK-----QNKRGPKPQSKTSGRGRGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVE-EFGNDNNGVMENLRAMRERKKS-------DVKADSKSP-VSPKVHSSPNNYRRKHASIKELKP---PSPITETPIEDPPAQII----MDELTPMLPAPVDMRTYDSYDNTT-----SYSDNIYETNTNVDDKVTDIVNTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIK--LPPPVEKEPVASST---VLQ--SESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNI--------PSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTN-HPVVP---PL-SRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTK-----YGSDDPK-----SNYFNNIRKEAT------------------TPKIKIKIG--GEQPMVTTM-EEKRSL--RPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFS------------------KAAPDE---AEVSAVTEPK--KASPIKLKISRCKEGYVMK 2357
            KKSPSKPTR+S+R  AQ  KSP         +++D    +KK      +KRG  P                 +  +D N   SKL GT YD D  E E G D+   +ENLRAMRER+KS       DV    K P VSPK  SS     R ++ I+E      P P       D    II    ++ + P+L APV++ +Y S+++TT      Y ++I E                       S  S+ ++ ++D +  ++++IK +K    P +E  PVAS+    V Q  ++SRNQLKVKIKGPFL+A Y       +   + T A  +N+        P+ +   + + S  SN R+MRKKELLRQY  Q  N++++ +  P+VP   PL +RN+ITIPKAVASMTTIPT+EDYKAVVDANMEKKR K      GSD  +     SN  N   +  T                  TPK+KIK+G  G+   VTT  E+K++L  RPPKKR+        + +  PT+E+L+R+SMKFRK V A F+E+        + +  + +KKR ++ +VS        K    V+VI   ++ PKLIIRF                   K +P++   +E SA+ + +  K SPI+LK+SRC++GYVMK
Sbjct: 1985 KKSPSKPTRTSARCIAQQAKSPGKSPGKSPKQLLD----IKKIKEGSTSKRGRPPGRGNLRGRGRGKGRGRGHGHSDPNTIHSKLVGTVYDFDIDEDEEGGDS---LENLRAMRERRKSSDVHDKKDVAIPIKEPSVSPKFVSSSTVKSRSYSDIRETDATFSPLPRRSKEAVDENQPIIENSRLEFVQPVLQAPVNVSSYSSFESTTTSTIPGYQNHIME-----------------------SYQSTNNESLKDFMEELEEEIKTLKSSTVPKIEA-PVASTVPEEVKQPSADSRNQLKVKIKGPFLDANY-------VTSAVVTQASVVNVISSSQAETPATTSTVAASLSTGSNLRRMRKKELLRQYWTQDMNMDESISITPIVPIQDPLINRNVITIPKAVASMTTIPTREDYKAVVDANMEKKRKKEKSLVEGSDVERRRSVGSNASNESSQNTTKRRGKTAKASSTSAPSSVTPKLKIKLGSSGDSASVTTFSEDKKNLRERPPKKRL--------SGVPKPTVEELKRESMKFRKMVMADFDEEEKT-----LESGNRKRKKRGNNNNVS--------KSCDMVRVI-TDDAAPKLIIRFGRRNEDTVQSNSLEPSVEVKHSPNDERTSECSALRKVRTSKTSPIRLKLSRCEKGYVMK 2591          

HSP 3 Score: 104.375 bits (259), Expect = 3.397e-18
Identity = 55/101 (54.46%), Postives = 77/101 (76.24%), Query Frame = 0
Query: 1249 QRSIFSPQQCNKD---IPDFDFDNDMLAVEQAANEEGFGLTRDTD-VRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIE 1345
            QRSIFSPQ  +KD      FDF+ND+LAV++  N++GF ++RD++ +R+ PL F+FN++FLFK DSKE +ARETLNLVEKLRL   KK+   E+ ++E +E
Sbjct: 1509 QRSIFSPQPPSKDSTVAELFDFENDILAVDETVNDDGFSMSRDSEEMRSHPLMFSFNSDFLFKIDSKEDSARETLNLVEKLRLDYAKKS-HTESSDVEVVE 1608          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|1339086405|ref|XP_023704242.1| (PHD finger protein rhinoceros [Cryptotermes secundus] >gi|1339086407|ref|XP_023704243.1| PHD finger protein rhinoceros [Cryptotermes secundus] >gi|1339086409|ref|XP_023704244.1| PHD finger protein rhinoceros [Cryptotermes secundus])

HSP 1 Score: 1059.67 bits (2739), Expect = 0.000e+0
Identity = 603/1064 (56.67%), Postives = 709/1064 (66.64%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGS------RSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDR-NSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPE--------KSNYTGL------KWPQSNNPYKRSYINGSIR-----YSSMSSSSDLELKPPR--------------------LISSERSSMDEAE---LIKSMLNKR------------KLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQF-----GSDDSEDVSLP-KLSSKRPTKVNNIYSDSDSEVSTKDD----------------SLSYTH---TKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTV---------------PTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKE-SDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEP------VKKDDSTTKSKR 956
            MS R KRQP   D+ P+P KRRK RP T +EEE  +     +G+       +D+KI SSIYN R  T+APAELFRKDLISAMKLPDSE LS D YW+I+DQWKQEWERGVQVPVNPDSLP       P V +   + S          +QH+EFKLPK KYIRITKDE F +EEH LS  P KAEK+CSYD+DD D AWL++ NGER   G   + +DQ ERV+EELE+RCWEKVQTI+K EEGLGIEYDENVICDVCRSPDSE+GNEMVFCD+CNICVHQACYGITTIPSGSWLCRTC L  RPECVLCPNK GAMKCTRSG KWAHVSCALWIPEVSIGCVE+MEPITKISSIP SRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDE+A+DGVKLRSYCQKHSVTSKK++  S SEDE+S ++KRKDMTSEEKNQARAAKLQEIE EF+KHVS+ D+TQ  DVD +G  YIYNYW LKR++G N+PLL PKS+D D+L  QQEQADLEK KMFVQLRQDLERVRNLCYMVSRREKLSR+   +REQTFHKQVAVL+D   +L   EV+A  EANHGPSIYDRLYS P A D S DF+ +L+RIAG  SP         K++  GL      K     NPYKR Y NG+ R     Y SMSS S+ +   P                     L  S  SS +E E   +    + KR            K  E++  KK   ++   +SS+EEE    K  W    ++ L Q+E++      GSDD++D+ LP K +   P K+N IYSDSDSE+S K D                S S  H   TKAA+KEFS G  + KV K    + +K   SL+K+ K++K++D  ++  +               PT+LIVPQRQAAKKATESI     +  E    ++   K+ SS+ +S  +V    K   K        K+   +   EK+ SD Q+  + VPQRQAAKKA   IKSGM+KPV    V EP       KKD +  K K+
Sbjct:    1 MSQRGKRQPNKTDDGPIPAKRRKCRPPTAEEEEATAMDAAAAGAVWTPRPLNDLKI-SSIYN-RSATEAPAELFRKDLISAMKLPDSEPLSPDEYWVITDQWKQEWERGVQVPVNPDSLPE------PTVTVNQCSGS---------RTQHHEFKLPKSKYIRITKDEFFTNEEHYLSSTPAKAEKACSYDLDDCDIAWLQILNGERACMGLHPVTEDQLERVIEELEIRCWEKVQTIVKTEEGLGIEYDENVICDVCRSPDSEEGNEMVFCDSCNICVHQACYGITTIPSGSWLCRTCALSLRPECVLCPNKGGAMKCTRSGQKWAHVSCALWIPEVSIGCVERMEPITKISSIPQSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENADDGVKLRSYCQKHSVTSKKEKSGSASEDEESKRKKRKDMTSEEKNQARAAKLQEIEAEFDKHVSIKDITQHMDVDPEGRQYIYNYWKLKRKAGFNKPLLPPKSEDADILSHQQEQADLEKMKMFVQLRQDLERVRNLCYMVSRREKLSRSFFRMREQTFHKQVAVLSDASCSLKGKEVAAVIEANHGPSIYDRLYSEPSALDHSGDFDLVLARIAGIASPRPGSADEKSKTDLNGLVKCSSDKKASLENPYKRLYFNGAGRRRSSLYGSMSSGSETDTAAPSRGGRHPSGSVSMRKTATRLGLPDSAASSTEEEEKHIVTTDSIRKRLPCNKKNSISGSKTVERKRCKKTFISRTKAESSSEEEEKPSKSLWQSPRSRTLRQMEQELGDKVSGSDDTDDLMLPVKATKSEPNKINAIYSDSDSELSLKGDASGGDRNESKSPSNIPSDSQQHVLRTKAAMKEFSAG-LQAKVDKSAQKNSTKLPRSLKKE-KEVKQEDSMDDDFIKDKENVKSSRKKEYDPTDLIVPQRQAAKKATESIRCSQGRTKEQILFEQEAFKVSSSNDES--KVKQKVKHKTKDSKTQKDGKSGSDVYDFEKDSSDPQEILAYVPQRQAAKKAAAHIKSGMSKPV----VGEPDAESLRTKKDPAEVKCKK 1039          

HSP 2 Score: 232.261 bits (591), Expect = 4.904e-57
Identity = 232/691 (33.57%), Postives = 329/691 (47.61%), Query Frame = 0
Query: 1786 SPSVTSSPHPNRTPSDKKSPSKPTRSSSRVTAQSYKSP--------EIVDHSPEVKKQNKRGPKPQSKTSGRGRGR---------------GRGRSSNHF--TDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKSDVKADSK----------SPVSPK----VHSSPNNYRRKH--ASIKELKPPSPITET--------PIEDPPAQIIMDEL-------TPMLPAPVDMRTYDSY------DNTTSYSDNIYETN---TNVDDKVTDIVNTLKEDLHNFSKLSSKD----KDIEDQLILIDDQIKIIKLPPPVEKEPVASSTVLQSESRNQLKVKIKGPFLNAKYNN-------IQNQPILPT---IDTSAISMNIPSHSVPPSEAASVPS--NFRQMRKKELLRQYCNQQDNIEQTTNHPV---------VPPLSRNIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTK--------------------YGSDDP------------KSNYFNNIRKEATTPKIK------------------------IKIG----GEQPMVTTMEEKR-SLRPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKE--STPKLIIRFSK 2323
            +P V SS     T + KKSP+KPTR+S+R  +Q  KSP             +P   +  + G   +S  SG+   R               GRG+   HF  +D+N   SKL GT YDL+F ++  +++   +ENLRAMRER++S    + K          SP SPK    +H  PN+  R    A I++L+PPSP+           P++ P      D L        P+LP PVDMRTY S       +N T Y +++  T+   +  +  V D V  L+++LH  S L+++     +   D++    D+  +      V     +S+ V  S+SRNQLKVKIKGPFL+A Y          Q QP+LP    +D  A+S  IP+ +   S AAS     N R+MRKKELLRQYC+Q  N++      V          PP++R +ITIPKAVASMT+IPT+EDYKAVVDANMEKKR K                       DD              SN  +  + ++ TP +K                        IKIG    G     + +EEK+  +RPPKKR+       T  +  PT+E+L+R+SMKFR+ + A F+E                +KK+    +  R+K+ + +    +VQ+I A E  S PKLIIR +K
Sbjct: 2339 TPKVASS----STAAGKKSPAKPTRTSARFISQQGKSPGKSPRQQDTASSKAPAQSRLRETGSSKRSSASGKLVNRVMYNQPRGGRRGRGRGRGQHMPHFAESDFNTIHSKLVGTVYDLEFDDDSPSES---VENLRAMRERRRSTDMHERKLSESTFLSRDSPPSPKFTSLLHQVPNSKLRSSYTADIRDLRPPSPLPGLRSSADELLPLQSPVNSTSSDRLEPFPDVVQPLLPGPVDMRTYSSSYEPTPSNNPTPYHNHLLGTSFSTSTAEQHVADFVEDLEKELH--SALAARKPPEPQKFTDEVSKQTDEALVSNATNDVS----SSNKVSLSDSRNQLKVKIKGPFLDANYAAASAVPPLTQQQPLLPVMPPLDAIAVSNIIPAATTAISSAASSSGTSNLRRMRKKELLRQYCSQDMNMDDPAGGAVTGQAVAPTAAPPVNRTVITIPKAVASMTSIPTREDYKAVVDANMEKKRRKEKAITSSISVPRELRHLDLPLDQDDACPPERRRSVGSTGSNASSTHQHDSITPPMKRRGRPPKSAVPASGPILVLAPKLKIKIGNNIIGAPEAESNVEEKKLRVRPPKKRL-------TTSVPMPTVEELKRESMKFRRMIMADFDE---------------AEKKQSKVIAGKRRKQRQFDSSQHEVQIITADERVSAPKLIIRINK 2994          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|1228008787|ref|XP_021936310.1| (PHD finger protein rhinoceros [Zootermopsis nevadensis] >gi|1228008789|ref|XP_021936311.1| PHD finger protein rhinoceros [Zootermopsis nevadensis] >gi|1228008791|ref|XP_021936312.1| PHD finger protein rhinoceros [Zootermopsis nevadensis] >gi|646700285|gb|KDR10489.1| PHD finger protein rhinoceros [Zootermopsis nevadensis])

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 592/1064 (55.64%), Postives = 703/1064 (66.07%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGS------RSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDR-NSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSPE--------KSNYTGL------KWPQSNNPYKRSYINGSIR-----YSSMSSSSDLELKPPR----------------------LISSERSSMDEA---ELIKSMLNKRK--------LKEKRLNKKRSKTKLSTDSSTEEENDKVKQK----WNVSPNKKLLQIEKQF-----GSDDSEDVSLP-KLSSKRPTKVNNIYSDSDSEVSTKDD----------------SLSYTH---TKAAVKEFSQGKSKTKVLKDKSTSVSKTKESLEKDTKKIKKDDPKNNTTV---------------PTELIVPQRQAAKKATESIHRVHNKHDEISNEKKSPEKLFSS--HRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKES-DLQDSFSIVPQRQAAKKAIQGIKSGMTKPV--EETKVSEPVKKDDSTTKSKR 956
            MS R KRQP   D+ P+P KRRK RP T +EEE  +     +G+       +D+KI SSIYN R  T+APAELFRKDLISAMKLPDSE LS D YW+I+DQWKQEWERGVQVPVNPDSLP       P V +     S  RS          +FKLPK KYIRITKD+ F +EEH LS  P KAEK+CSYD+DD D AWL++ NGER   G   I +DQ E V+EELE+RCWEKVQTI+K EEGLGIEYDENVICDVCRSPDSE+GNEMVFCD+CNICVHQACYGITTIPSGSWLCRTC +  RPECVLCPNK GAMKCTRSG KWAHVSCALWIPEVSIGCVE+MEPITKISSIP SRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDE+A+DGVKLRSYCQKHSVTSKK++  S SEDE+S ++KRKDMTSEEKNQARAAKLQEIE EF+KHVS+ D+TQ  DVD +GI YIYNYW LKR++  N+PLL P+S+D D+L  QQEQADLEK KMFVQLRQDLERVRNLCYMVSRREKLSR    +REQTFHKQ  VL+D   NL   EV+A  EANHGPSIYDRLYS P A D S DFE +L+RIAG  SP+        K++  GL      K     NPYKR Y NG+ R     Y SMSS S+ +   P                       L  S  SS +E     +    + KR            K +++KRS+    + +  E  +++ ++     W    ++ L Q+E++      GSDD++D+ LP K ++  P K+N IYSDSDSE+S K D                S S  H   TKAAVKEFS G  +TKV +    + +K+  S +K+ K++K+DD  ++  +               PT+LIVPQRQAAKKATESI     +  E    ++   K+  S    K+ ++V   T+    Q       ++   +   EK+S D Q+  + VPQRQAAKKA   IKSGMTKPV  E    S   +KD    KSK+
Sbjct:    1 MSQRGKRQPNRTDDGPIPAKRRKCRPPTAEEEEMTAMDAAAAGAVWTPRPLNDLKI-SSIYN-RSATEAPAELFRKDLISAMKLPDSEPLSPDEYWVITDQWKQEWERGVQVPVNPDSLPQ------PTVTVNQCCSS--RS--------QQDFKLPKSKYIRITKDDFFTNEEHFLSNTPAKAEKACSYDLDDCDVAWLQIVNGERACMGLHPITEDQLECVIEELEIRCWEKVQTIVKTEEGLGIEYDENVICDVCRSPDSEEGNEMVFCDSCNICVHQACYGITTIPSGSWLCRTCAIGLRPECVLCPNKGGAMKCTRSGQKWAHVSCALWIPEVSIGCVERMEPITKISSIPQSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDENADDGVKLRSYCQKHSVTSKKEKSGSASEDEESKRKKRKDMTSEEKNQARAAKLQEIEAEFDKHVSIKDITQHMDVDVEGIQYIYNYWKLKRKAAFNKPLLPPRSEDVDILSHQQEQADLEKMKMFVQLRQDLERVRNLCYMVSRREKLSRTFFRMREQTFHKQAVVLSDVSCNLKGKEVAAVIEANHGPSIYDRLYSEPSAEDHSGDFELVLARIAGITSPKPSTADEKNKTDLNGLVKCSSDKKTSLENPYKRLYFNGAGRRRSSLYGSMSSGSETDTAAPSRGSRRPSCNVSVRKTPATVRLGLADSAASSTEEEGKHSITTDCVRKRPPCNRKNSVSGSKAIDRKRSRKAFISRTKVESSSEEEEKSSKILWQSPRSRTLRQMERELGDKVSGSDDTDDLMLPVKATNSEPNKINAIYSDSDSELSLKGDISGGDRNENKSPSNIPSDSQQHVLRTKAAVKEFSAG-FQTKVDRSPQKNNAKSSRSFKKE-KELKQDDSMDDDFIKDKENVKSARKKEYDPTDLIVPQRQAAKKATESIRCSQGRTKEQILFEQEAFKISPSIEEPKARQKVRHKTRDSKTQ-------RSGGDIYDFEKDSCDAQEILAYVPQRQAAKKAAAHIKSGMTKPVVGELDAESARTRKDQVELKSKK 1037          

HSP 2 Score: 102.834 bits (255), Expect = 1.045e-17
Identity = 52/91 (57.14%), Postives = 70/91 (76.92%), Query Frame = 0
Query: 1249 QRSIFSPQQCNKDIPD---FDFDNDMLAVEQAANEEGFGLTRDTD--VRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKKTV 1334
            QRS+FSPQQ +KD P    FDF+ND+LAV++  N++GF + RD++  +R  PL+F+F++EFLFK+DSKE +ARET  LVEKLRL   KKT 
Sbjct: 1785 QRSLFSPQQPSKDPPVSELFDFENDILAVDETVNDDGFTIARDSEEIMRAPPLTFSFSSEFLFKEDSKEDSARETHLLVEKLRLEYAKKTT 1875          
BLAST of XM_015507633.1 vs. GenBank_protein
Match: gi|1101350703|ref|XP_018901311.1| (PREDICTED: PHD finger protein rhinoceros-like [Bemisia tabaci] >gi|1101350705|ref|XP_018901312.1| PREDICTED: PHD finger protein rhinoceros-like [Bemisia tabaci])

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 553/973 (56.83%), Postives = 671/973 (68.96%), Query Frame = 0
Query:    1 MSYRTKRQPISKDECPLPTKRRKGRP-----------STLQEEEEASSLDTQSGSRSDMKIPSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEWERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKLPKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGERTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICDVCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPECVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIPPSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDESAEDGVKLRSYCQKHSVTSKKDR-NSGSEDEDSTKRKRKDMTSEEKNQARAAKLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLLPKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRNLLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDAPDLSTDFETMLSRIAGDGSP-----EKSNYTG-LKWPQSNNPYKRSYINGSIR-------YSSMSSSSDLELKPP-RLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTKLSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDV--SLPKLSSKRPTKVNNIYSDSDSEVSTKD--DSLSYTHTKAAVKEFSQGKSKTKVLKDKSTS---VSKTKESLEKDTKKIKKDDPKNNTT-VPTELIVPQRQAAKKATESIHRVHNKH---------DEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLSSVEKE-SDLQDSFSIVPQRQAAKKAIQGIK 929
            MS+R KRQ   +D+ P+P+KRRKGRP            T   E++  S+   S S +D    SSIYN R  T+APAELFRKDLISAMKLPDSE L+ D YW+I+DQWKQEWERGVQVPVNPDSLPG SV    VV  + + +             H EFKLPK+KYI I K EHF  +E  LS +P KAEK+  YD+DD D AWL + NGER   G   I + Q E V+EELE+RCW+KVQTI+KEEEGLGIE+DENVICDVCRSPDSE+GNEMVFCD CNICVHQACYGI +IPSG WLCRTC L  RPECVLCPNK GAMKCTRSG +WAHVSCALWIPEVSIGCVEKMEPITKISSIP SRWALICVLCRERVGACIQCSVKTCK AYHVTCAFKHGLEM+AIIEDESA+DGVKLRSYCQKHSVTSK+D+  S SED+D+ +++RKDMTSEEKN AR AKLQEIE EFEKHVS  DV +  +VD+DG+ +IYNYWV+KRR+G NRPLL PKSDD ++L RQQEQAD+EK K FVQLRQDLERVRNLCYMV RREKLSR+ L LREQTF KQVAVL++ + ++SS E++A +EANHGPSIYDRLYS+P APDLSTDFETML+RI G  SP      K +  G  +    +NPYKR Y NG +        Y  +SS+SD + KP  +   S  SSMDE    K   ++  +K K+  KKR + K + D ++  ++++ K  W  S   + +  + + GS+DSE +  S PK    + +             + ++  D+     TKAA+KEF   ++K+K    K  S   V+   +   +D + IK +  K  T+  P++LIVPQRQAAKKATESIHR   +          +EIS +    E++ S   KS  +    +K   K P K   +K +  +   EKE  D Q+  + VPQRQAAKKA + IK
Sbjct:    1 MSHRGKRQ-APRDDGPVPSKRRKGRPPGTHSHCGGSQGTGGGEDDEDSIWGSSRSLADQLKASSIYN-RTVTEAPAELFRKDLISAMKLPDSEPLAADEYWMITDQWKQEWERGVQVPVNPDSLPGPSVT---VVSHRPAHR-------------HAEFKLPKNKYIHIHKTEHFTPDEFVLSNMPAKAEKAILYDLDDCDVAWLNIYNGERAGMGQQPINESQLEAVIEELEVRCWDKVQTIVKEEEGLGIEFDENVICDVCRSPDSEEGNEMVFCDMCNICVHQACYGIMSIPSGQWLCRTCHLGIRPECVLCPNKGGAMKCTRSGQRWAHVSCALWIPEVSIGCVEKMEPITKISSIPQSRWALICVLCRERVGACIQCSVKTCKIAYHVTCAFKHGLEMKAIIEDESADDGVKLRSYCQKHSVTSKRDKCGSASEDDDTKRKRRKDMTSEEKNLARQAKLQEIEAEFEKHVSPKDVAKRHEVDSDGVNFIYNYWVMKRRAGGNRPLLAPKSDDVEILARQQEQADMEKMKNFVQLRQDLERVRNLCYMVERREKLSRSFLKLREQTFLKQVAVLSEARTSISSTELTAIKEANHGPSIYDRLYSHPAAPDLSTDFETMLTRICGMASPTPEDKAKLDLNGFFRNNNKDNPYKRMYFNGGVVRSRRSSIYGGISSNSDTDTKPKIKEEESALSSMDERPSSKLGYDRIGVKGKKRPKKR-ELKSTKDPNSSTDDEEPKSSWEKSRASRKIDKDDRTGSEDSEGLFESFPKYEHTKLSTSIYSSDSDSESSAKEETSDAHQSIRTKAAMKEFIPDEAKSKKSSSKPVSTKRVNSIDDEFVRDKENIKSNKKKKETSGAPSDLIVPQRQAAKKATESIHRSQGRPKLEQNALDINEISRKSPVVEEIPS---KSKHQKKDMSKFKSKIP-KDKDLKTSNDVYEFEKELGDGQEILAYVPQRQAAKKAAEHIK 950          

HSP 2 Score: 233.417 bits (594), Expect = 2.485e-57
Identity = 259/759 (34.12%), Postives = 374/759 (49.28%), Query Frame = 0
Query: 1732 VSQQNIINQTPVQTPI-SVSQVSNQTTP-SIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSP------HPNRTPS-----DKKSPSKPTRSSSRVTAQSY---KSPEIVDHSP---EVKKQNKRGPKPQSKTSGRGRGRGR-------GRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMRERKKS-DV------------KADSKSP--VSP-KVHSSPNNYRRKHASIKELKPPSP---------ITETPIEDPPAQIIMDELTPMLPAPVDMRTYDSYDNTTS------YSDNIYET-NTNVDDKVTDIVNTL-KEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPV-ASSTVLQSESRNQLKVKIKGPFLNAKY---NNIQNQPILPTIDTSAISMNIPSHSVPPSEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSR--NIITIPKAVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKE---------------ATTPKIKIKIGGEQPMVTTMEEKRSL--RPPKKRICDTQNDDTNHLIAPTMEQLRRDSMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNKEISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAV--------------------TEPKKASPIKLKISRCKEGYVMKPPSNQTNPDTSLNN------------NCEVR 2376
             S  N+     + +PI SV+      TP S P P    + P + L E    S  ++S S ++ P       P+ TPS      KKSP+KPTR S+RV +Q     KSP     SP   E  K   R  +   KT G GRG+ R       GR  N   D N   SKL GT Y+ DF E+  +++   +ENLR+MRER+KS DV            K  S+SP   SP  V +S        +S++EL+PPSP         + + P+   P      ++ P+LP PVDMRTY +  N +S      Y DN+    +T+  + V D+V+   K + ++ +K ++ ++ I  +           K P  V+++   A+  +  S+SRNQLKVKIKGPFL+A Y   N    QP L  ++  + +          +   S  S+ R+MRKKELL+QY  +  N   T + P   P +R    I+IPKAV SM++IPT++DYKAVVDANMEKK+ K    D   ++ ++   +                TTPK+KIKI   QP V   E+K++L  RPPKKR+  T +      I P  ++ ++D+M +R+++ A FE++           V +  K++       +KKK R+N     V+VI A E TPK+II+F K  PDE   S V                    T   K +PIKLK+SRC+EGYVMK P +  N  +SLN+            +C+VR
Sbjct: 2087 ASSHNMALTAAMVSPIPSVAPQERSITPVSFPEPVPVQSQPNSVLNEPMTASPASNSESFSTQPPTPITAEPSPTPSVKSFPGKKSPTKPTRVSARVLSQQKSPGKSPGTPGKSPRQIEPPKPIARAREATKKTKGAGRGQNRTPRGRGRGRGKNQMFDDNTIHSKLVGTVYEFDFDEDSPSES---VENLRSMRERRKSSDVHERKSSDSSFISKDSSQSPKFASPVHVQNSSKRSTTYSSSVRELRPPSPVSEEPPSNSVEDGPVVQEPKLAPFQDVEPLLPGPVDMRTYSAPYNASSNSTINSYHDNLISGFSTSAAEHVPDLVDEFEKFEEYSLTKTTTDEEPIASK-----------KTPKEVKQDANDAAYKMSLSDSRNQLKVKIKGPFLDANYVTSNAAPQQPPLTPLEGGSAAA---------APTGSGTSHLRRMRKKELLQQYVTEDMN---TVSPPSTVPPTRVPTTISIPKAVNSMSSIPTRDDYKAVVDANMEKKKKKDRFSD--LSFISDDDDKFGDDKHPVVTLSPLPTTTPKLKIKIREPQPTVVKTEDKKNLRQRPPKKRLSTTSSS-----IQPPHDKYKQDAMLYRQRMMADFEDEEEE------IVVTRKPKEKPKKKEKEKKKKHRSN----NVEVI-ADEKTPKIIIKFKK--PDENSNSTVEETLNKTKLNKSSEASSASKTRTPKTTPIKLKLSRCEEGYVMKTPCD--NGASSLNDSESSANSLPLSQDCQVR 2797          

HSP 3 Score: 83.9593 bits (206), Expect = 4.502e-12
Identity = 45/92 (48.91%), Postives = 58/92 (63.04%), Query Frame = 0
Query: 1247 GSQRSIFSPQQCNK------DIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTFNNEFLFKDDSKEITARETLNLVEKLRLGITKK 1332
            G  RSIFSPQ  +K      D    DF ND+LAV++  +++GF + RD++       F+F NE LFK D KE +A+ETLNLVEKLRL   KK
Sbjct: 1549 GHHRSIFSPQASSKEGATADDDLFADFSNDILAVDETVHDDGFSIPRDSEESMRAHPFSFGNELLFKPDLKEDSAQETLNLVEKLRLDYAKK 1640          
The following BLAST results are available for this feature:
BLAST of XM_015507633.1 vs. GenBank_protein
Analysis Date: 2018-05-22 (Blastp: NCBI Gnomon 20160302 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|985391724|ref|XP_015363118.1|0.000e+099.96PREDICTED: PHD finger protein rhinoceros isoform X... [more]
gi|985391728|ref|XP_015363121.1|0.000e+099.03PREDICTED: PHD finger protein rhinoceros isoform X... [more]
gi|641658231|ref|XP_008180648.1|0.000e+094.87PREDICTED: PHD finger protein rhinoceros isoform X... [more]
gi|1028690027|ref|XP_016657953.1|0.000e+094.24PREDICTED: PHD finger protein rhinoceros isoform X... [more]
gi|1229879311|ref|XP_022183568.1|0.000e+093.06PHD finger protein rhinoceros isoform X1 [Myzus pe... [more]
gi|1229879317|ref|XP_022183571.1|0.000e+092.39PHD finger protein rhinoceros isoform X2 [Myzus pe... [more]
gi|939233711|ref|XP_014241583.1|1.784e-6058.44PREDICTED: PHD finger protein rhinoceros [Cimex le... [more]
gi|1339086405|ref|XP_023704242.1|4.904e-5756.67PHD finger protein rhinoceros [Cryptotermes secund... [more]
gi|1228008787|ref|XP_021936310.1|1.045e-1755.64PHD finger protein rhinoceros [Zootermopsis nevade... [more]
gi|1101350703|ref|XP_018901311.1|2.485e-5756.83PREDICTED: PHD finger protein rhinoceros-like [Bem... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0019058 viral life cycle
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0016740 transferase activity
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan on NCBI Gnomon 20160302
Date Performed: 2018-05-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 357..415
e-value: 5.1E-6
score: 36.0
coord: 248..294
e-value: 2.0E-11
score: 54.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 298..417
e-value: 2.0E-27
score: 97.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3D3.30.40.10coord: 234..297
e-value: 8.8E-22
score: 78.4
NoneNo IPR availablePFAMPF13832zf-HC5HC2H_2coord: 300..414
e-value: 3.7E-30
score: 104.2
NoneNo IPR availablePFAMPF13831PHD_2coord: 261..294
e-value: 1.3E-12
score: 47.0
NoneNo IPR availablePANTHERPTHR13793:SF27PROTEIN JADE-3coord: 1642..1814
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 672..841
NoneNo IPR availablePANTHERPTHR13793:SF27PROTEIN JADE-3coord: 672..841
coord: 2199..2289
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 1642..1814
coord: 30..568
NoneNo IPR availablePANTHERPTHR13793PHD FINGER PROTEINScoord: 866..1062
coord: 2199..2289
NoneNo IPR availablePANTHERPTHR13793:SF27PROTEIN JADE-3coord: 866..1062
coord: 30..568
NoneNo IPR availableCDDcd15707ePHD_RNOcoord: 301..414
e-value: 1.30002E-78
score: 252.9
NoneNo IPR availableCDDcd15573PHD_JADEcoord: 248..293
e-value: 5.72381E-32
score: 117.125
IPR019542Enhancer of polycomb-like, N-terminalPFAMPF10513EPL1coord: 132..222
e-value: 1.1E-10
score: 42.1
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 249..293
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 246..296
score: 9.988
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 298..415
score: 40.489
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILY57903FYVE/PHD zinc fingercoord: 236..307

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:642734..652114 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on NCBI Gnomon 201603022018-05-22
Blastp: NCBI Gnomon 20160302 vs NR2018-05-22
Blast2GO on NCBI Gnomon (20160302)2018-05-22
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
XM_015507633.1rna3663Diuraphis noxiamRNAJOTR01000065 637477..652498 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>rna3663 ID=rna3663|Name=XM_015507633.1|organism=Diuraphis noxia|type=polypeptide|length=2377bp
MSYRTKRQPISKDECPLPTKRRKGRPSTLQEEEEASSLDTQSGSRSDMKI
PSSIYNTRITTDAPAELFRKDLISAMKLPDSEQLSTDAYWIISDQWKQEW
ERGVQVPVNPDSLPGSSVHEIPVVCLQSSTKSPRRSPSSIYHSQHNEFKL
PKHKYIRITKDEHFKSEEHQLSLLPLKAEKSCSYDMDDVDTAWLKLCNGE
RTLGGFPKIKDDQFERVMEELEMRCWEKVQTIIKEEEGLGIEYDENVICD
VCRSPDSEDGNEMVFCDNCNICVHQACYGITTIPSGSWLCRTCTLRFRPE
CVLCPNKNGAMKCTRSGHKWAHVSCALWIPEVSIGCVEKMEPITKISSIP
PSRWALICVLCRERVGACIQCSVKTCKTAYHVTCAFKHGLEMRAIIEDES
AEDGVKLRSYCQKHSVTSKKDRNSGSEDEDSTKRKRKDMTSEEKNQARAA
KLQEIEGEFEKHVSVIDVTQCRDVDNDGILYIYNYWVLKRRSGNNRPLLL
PKSDDGDLLGRQQEQADLEKHKMFVQLRQDLERVRNLCYMVSRREKLSRN
LLSLREQTFHKQVAVLTDNKLNLSSAEVSAXQEANHGPSIYDRLYSYPDA
PDLSTDFETMLSRIAGDGSPEKSNYTGLKWPQSNNPYKRSYINGSIRYSS
MSSSSDLELKPPRLISSERSSMDEAELIKSMLNKRKLKEKRLNKKRSKTK
LSTDSSTEEENDKVKQKWNVSPNKKLLQIEKQFGSDDSEDVSLPKLSSKR
PTKVNNIYSDSDSEVSTKDDSLSYTHTKAAVKEFSQGKSKTKVLKDKSTS
VSKTKESLEKDTKKIKKDDPKNNTTVPTELIVPQRQAAKKATESIHRVHN
KHDEISNEKKSPEKLFSSHRKSPERVSSNTKSPDKQPIKVNKIKNAEKLS
SVEKESDLQDSFSIVPQRQAAKKAIQGIKSGMTKPVEETKVSEPVKKDDS
TTKSKRSAKSSLSSTSSSSSSSSSSSTSSTSSSSSSSGSSTSESDTEPEK
KNKSIDRVSPPKEISKTKSPPKAKGWLSENKPIKISSSSSSESDKDQKVI
RAPDKKLKTSDRRPEHRFQDPPPKREESRRKSIGSDRCDSVQIVTCGDSS
IGDDGNRKSSDSDNVGTSTSQPDGIKQETKQPIHAVEDKEVEKKLKLDDG
DQRVLKEDHGLNKNIQEVKNKNVTPVQHTSDKENKKTDELNLYLPGGHRL
NDLKDENLLSSSFLTRQDIERELVNNIDYDNKKYSKMXFNCNNHFSGSQR
SIFSPQQCNKDIPDFDFDNDMLAVEQAANEEGFGLTRDTDVRNAPLSFTF
NNEFLFKDDSKEITARETLNLVEKLRLGITKKTVPLENENIENIELNDTP
KILDPPKPSEPEQKTDNILYNAYNKFHQQSNDVVDVNKVPERDKLDRSES
ALSDERWVPPSQRSQAESPYQDINDANRWSDSVVMPSRRSDTSNEPSPEH
QNPPTTESLYQNIHSFPTSVPMQIESMQFPQFSEPSFVLNPPSSNQLSFM
SSSRNFNPQQFAIPPPFSAHQNLMPELNKPLHLQQTPCTAAFTSSTQNMA
FTAAMISPMTHHDNFIPPFNDISMYNDSNLLMGPSTNNSSLHSESVMHTV
FNAINQASMIDNQLSILPTIQTPKTPKVSTSNQISGSHXLIPASTNNQTQ
EINLQSTSNQHQVPVTSNNQTEITLSQSISNNQEPVFSQSKINSEQVTPK
NQLAAPISNQIPLNKQQSIPEVHTPLVCQAEVSQQNIINQTPVQTPISVS
QVSNQTTPSIPTPKQSPALPTTPLPERSPMSIIASSPSVTSSPHPNRTPS
DKKSPSKPTRSSSRVTAQSYKSPEIVDHSPEVKKQNKRGPKPQSKTSGRG
RGRGRGRSSNHFTDYNPAVSKLAGTAYDLDFVEEFGNDNNGVMENLRAMR
ERKKSDVKADSKSPVSPKVHSSPNNYRRKHASIKELKPPSPITETPIEDP
PAQIIMDELTPMLPAPVDMRTYDSYDNTTSYSDNIYETNTNVDDKVTDIV
NTLKEDLHNFSKLSSKDKDIEDQLILIDDQIKIIKLPPPVEKEPVASSTV
LQSESRNQLKVKIKGPFLNAKYNNIQNQPILPTIDTSAISMNIPSHSVPP
SEAASVPSNFRQMRKKELLRQYCNQQDNIEQTTNHPVVPPLSRNIITIPK
AVASMTTIPTKEDYKAVVDANMEKKRTKYGSDDPKSNYFNNIRKEATTPK
IKIKIGGEQPMVTTMEEKRSLRPPKKRICDTQNDDTNHLIAPTMEQLRRD
SMKFRKKVFARFEEDALASTSIPIATVAKNKKKRRSSPSVSRKKKPRTNK
EISQVQVIEAKESTPKLIIRFSKAAPDEAEVSAVTEPKKASPIKLKISRC
KEGYVMKPPSNQTNPDTSLNNNCEVR.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0016740transferase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0019058viral life cycle
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR001965Znf_PHD
IPR013083Znf_RING/FYVE/PHD
IPR019542Enhancer_polycomb-like_N
IPR019786Zinc_finger_PHD-type_CS
IPR019787Znf_PHD-finger
IPR034732EPHD
IPR011011Znf_FYVE_PHD