rna3669 (polypeptide) Diuraphis noxia

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameXM_015507628.1
Unique Namerna3669
Typepolypeptide
OrganismDiuraphis noxia (Russian wheat aphid)
Sequence length1783
Homology
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|985391716|ref|XP_015363114.1| (PREDICTED: endoribonuclease Dcr-1 isoform X2 [Diuraphis noxia])

HSP 1 Score: 3694.82 bits (9580), Expect = 0.000e+0
Identity = 1780/1782 (99.89%), Postives = 1780/1782 (99.89%), Query Frame = 0
Query:    1 MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK 1782
            MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKT DAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSP LRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK
Sbjct:    1 MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTJDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPJLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK 1782          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|985391714|ref|XP_015363113.1| (PREDICTED: endoribonuclease Dcr-1 isoform X1 [Diuraphis noxia] >gi|985391720|ref|XP_015363116.1| PREDICTED: endoribonuclease Dcr-1 isoform X1 [Diuraphis noxia])

HSP 1 Score: 3694.05 bits (9578), Expect = 0.000e+0
Identity = 1779/1781 (99.89%), Postives = 1779/1781 (99.89%), Query Frame = 0
Query:    2 KSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK 1782
            KSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKT DAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSP LRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK
Sbjct:   60 KSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTJDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPJLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK 1840          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|985391718|ref|XP_015363115.1| (PREDICTED: endoribonuclease Dcr-1 isoform X3 [Diuraphis noxia])

HSP 1 Score: 3653.6 bits (9473), Expect = 0.000e+0
Identity = 1759/1761 (99.89%), Postives = 1759/1761 (99.89%), Query Frame = 0
Query:   22 MFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK 1782
            MFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKT DAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSP LRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK
Sbjct:    1 MFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTJDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPJLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK 1761          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|1229879669|ref|XP_022183763.1| (endoribonuclease Dcr-1 [Myzus persicae] >gi|1229879672|ref|XP_022183764.1| endoribonuclease Dcr-1 [Myzus persicae])

HSP 1 Score: 3502.22 bits (9080), Expect = 0.000e+0
Identity = 1678/1772 (94.70%), Postives = 1725/1772 (97.35%), Query Frame = 0
Query:    2 KSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSV-NHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCA 1772
            K EKRKWTLLVLEETEIDQYMFSI HLTDLKPL +RSV N LDFINYEVI+TTENLCLE+FEKKYL FDQLNLAIFNNCQKII +NSTY+KICNFIKPNSKCRILGIVHPLFE DSDPFFIENQLKFISHKL SSIETASDIVSILRHCCKPKEVLIECA+ TEDLTNIKIK+MVQSLTEFL++HNYEP+IIYGDDEEFGEELKQIPNPKNEPLQMIADFL++LKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKAD+N VEVC DQKEKKDRTIKSKS+RRNWKLARRYGTHRKQGRSRDPYEETVCAI+LVNNKMTASILYYLFLDLKNSNK+DFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKT DAHY+LMFDE ATSNILS  KLYKDINQMLL+HCTLKDIDMEKEI ADRYNW VTPFKPGK EDS FVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEA NDCRPVEGK CHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRD SG IDIDW FLDNMHKC+DNKLSIITNEDRIHFQP+IEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKY LKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDH+WEPLDFGWTMKDVLIKRKEQKEIS IKV EPVETVKQ VDE+IKEEKIDKSDDPNWMDIGTWSNDMADFAMNNID+TTKVRYSSPTSWMIQSDNESSTFSD+DSDDGIQVNGLH NGLRIEFRNTYLAEAVDENDSKTNKL FF+NNETPQLWTWN++ HS+TEYNSNQQD+QII+LFYKKDD+IIINREVKSSTNIDS SLLKLPWELN+NTGYGLSDINVL +KTSF+PED   IKSE +I +KT DSVN+VHGV++ETFSFD+QPDLN+HPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALI+ASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGF NE+ ENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGI+VLP+L DSKLGYLKPPSSP LRNVD+PEGEL KLMDGFESFEQHLGY FQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGL+EVVCRFVTIQEENGH IDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCA
Sbjct:   60 KCEKRKWTLLVLEETEIDQYMFSIRHLTDLKPLAVRSVDNLLDFINYEVIVTTENLCLEMFEKKYLHFDQLNLAIFNNCQKIIVKNSTYFKICNFIKPNSKCRILGIVHPLFELDSDPFFIENQLKFISHKLFSSIETASDIVSILRHCCKPKEVLIECAVQTEDLTNIKIKSMVQSLTEFLSEHNYEPSIIYGDDEEFGEELKQIPNPKNEPLQMIADFLDVLKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADNNIVEVCNDQKEKKDRTIKSKSVRRNWKLARRYGTHRKQGRSRDPYEETVCAIVLVNNKMTASILYYLFLDLKNSNKDDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTLDAHYVLMFDEVATSNILSCFKLYKDINQMLLSHCTLKDIDMEKEIHADRYNWFVTPFKPGKNEDSAFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEALNDCRPVEGKPCHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDASGSIDIDWNFLDNMHKCRDNKLSIITNEDRIHFQPNIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYNLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHIWEPLDFGWTMKDVLIKRKEQKEISIIKVPEPVETVKQFVDEEIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDNTTKVRYSSPTSWMIQSDNESSTFSDIDSDDGIQVNGLHPNGLRIEFRNTYLAEAVDENDSKTNKLYFFKNNETPQLWTWNNDCHSITEYNSNQQDEQIINLFYKKDDEIIINREVKSSTNIDSSSLLKLPWELNSNTGYGLSDINVLLNKTSFMPEDSEYIKSETYIDSKTIDSVNQVHGVRTETFSFDYQPDLNDHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALINASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFSNENIENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIRVLPSLDDSKLGYLKPPSSPLLRNVDNPEGELIKLMDGFESFEQHLGYRFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLSEVVCRFVTIQEENGHAIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCA 1831          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|328716579|ref|XP_001944314.2| (PREDICTED: endoribonuclease Dcr-1 [Acyrthosiphon pisum])

HSP 1 Score: 3154.39 bits (8177), Expect = 0.000e+0
Identity = 1519/1599 (95.00%), Postives = 1558/1599 (97.44%), Query Frame = 0
Query:  174 MVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCA 1772
            MVQSLT+FL DHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLE+L TMGPYCADKAALTLLYMVEKLKVKTPYERHYVL CIVST+LIQIRATFD+IF NYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKAD+N VEVCK+QKEKKD++IKSKS+RRNWKLARRYGTHRKQGRSRDPYEET+CAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKT DAHYILMFDEDATSNILSRLKLYKDINQMLL+HCTLKDIDMEKE +ADRYNW VTPFKPGKKEDS FVDMATAIGLVNRYCAKLPSDTFTKLSPIWK QSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHS GELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEA NDCRPVE K CHLYAILLNMNCPVPEEQNTRGRRIHPPEES+HGFGILT+KHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRD SG IDIDW FLDNMHKC+DNKLSIITNEDR++FQPDI+VLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKY LKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLG VNLSFDH WEPLDFGWTMKDVLIKRKEQKEIS IKV EPVETVKQ VDE+IKEEKIDKSDDPNWMDIGTWSNDMADFAMNNID+TTKVRYSSPTSWM+QSDNESSTFSD+DSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKL FF+NNETPQLWTWND+ HSVTEYNSNQQD+QII+LFYKKDD+IIINREVKS++NIDS SLLKLPWELN+NTGYGLSDI+VLS+ T FIPED   IKSEI I  K  DSVN+VHGVQ+ TFSFDFQPDLN+HPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALI+ASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGF NED ENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGI+VLPTL DSKLGYLKPPSSP LRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGL++VVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCA
Sbjct:    1 MVQSLTQFLTDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEVLNTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLFCIVSTMLIQIRATFDNIFNNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADNNIVEVCKEQKEKKDKSIKSKSVRRNWKLARRYGTHRKQGRSRDPYEETICAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTLDAHYILMFDEDATSNILSRLKLYKDINQMLLSHCTLKDIDMEKETYADRYNWFVTPFKPGKKEDSAFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKTQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSHGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEALNDCRPVENKPCHLYAILLNMNCPVPEEQNTRGRRIHPPEESVHGFGILTIKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDASGSIDIDWNFLDNMHKCRDNKLSIITNEDRMNFQPDIDVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYSLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGSVNLSFDHTWEPLDFGWTMKDVLIKRKEQKEISIIKVDEPVETVKQFVDEEIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDNTTKVRYSSPTSWMVQSDNESSTFSDIDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLFFFKNNETPQLWTWNDDCHSVTEYNSNQQDEQIINLFYKKDDEIIINREVKSNSNIDSSSLLKLPWELNSNTGYGLSDISVLSNNTPFIPEDSKYIKSEININYKINDSVNEVHGVQTGTFSFDFQPDLNDHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALINASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFSNEDIENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIRVLPTLDDSKLGYLKPPSSPLLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLSDVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCA 1599          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|1028720528|ref|XP_016663133.1| (PREDICTED: endoribonuclease Dcr-1-like, partial [Acyrthosiphon pisum])

HSP 1 Score: 2694.84 bits (6984), Expect = 0.000e+0
Identity = 1337/1781 (75.07%), Postives = 1466/1781 (82.31%), Query Frame = 0
Query:    2 KSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRY--GTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDN-GHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKK 1779
            KSEKRKWTLLVLEE E+DQYMFSI HLTDLKPL+IRSV+H DFINY+VI+TTENLCLE+FEK  L FDQL+LAIFNNCQKII ENSTY+KICNFIK NS+CRILGIVHPLFE DSDP FIENQLKFISHKL SSIETASDIVS+LR CCKPKEVLIECA+ +ED  NI IK++VQSLT+FLNDHNY P  IYGDDEE  EELK+IP PKN PLQMI++F ++LKTMGPYCADK ALTLLY +E LKVKTPYERHY LLCIVSTLLIQIRA FD+IFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSF +++N  EVCKDQ+  KD+ IKSKS +RN KL RRY   THRKQ +SRDP EE VCAIILVN+KMTAS+LY+LFLDLKNSN+EDFGWI+PQY VD  ADPITEP+EFEIE K QE  L+RFRQR CNVLIGTK LE GI+LPRCNLVINYN+PLSYKSYL SKS+A+T DA+Y+LMFDE ATS ILS  +LYKDINQMLL+HCTLKDIDMEKEI+ADR+NW V+PFKPGKKEDS FVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQS+VYENQPMFVCSIRLPINSPIKH+IHGHPMPCEILAKRIAALEVCRQ++SQG+LDDTLQPITKESFHALFN DE++PD ED+LI   T++  PGT KRRQ+YYKR AEA NDCRPVEGK CHLYAILLN+ CP+PE++NT+ RRIHPPEESIHGFGILT KHIPSIP FPIY RCGEVYV LK IKTDMFLTQHQLDNIATFLNYTF+NVL  +KC V F+PTTTHNCYYIVPTLRD SG ID+DWK LDN+   +DNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQP+YFYV EICTHLNPKSPFP   E YKTFED+YY KY LKIQNLEQPLLDVD TSARLNFLTPRYMN KG  LPTSSDATKRAKR +LS KQILVPELCN+HLFPASMWR AVSLP ILYRINALLLADEIRTIVAKD SLGLVNLSFDH+W+PLDFGW +KDVLI+RKEQKEISTIKV EPVETVK+ +DE  KEEKID+ +DPNWM+IGTWSNDMADFAMNNID+TTK RYS P S MIQS++ESSTFSD++SDDGIQVN                 E    ++  ++ LL     + P  W  N N G+ +++ N    +      F  +DD  I N   K++  IDS++                               + ND+++E F                    SFDFQPDLN HPGPSPS+LLQALT +NA DG +LERLETIGDSFLKYA+TAYLYCTH+NVHEG LS LRS  VSNLNLYRLGKLKMFGERMISTKFEP  NWLPPCY  PHKLEKA+I+++I                                                +TQH   DKSIADCVEALIGAYLISCG RGALLFMSWLGI VL TL DSKLGYLK P SP LRNV+DPEGELTKLMDGFESFEQHLGY+FQDRSYLLQAMTHASYYPN LTDCYQRLEFLGDAVLDYLITRHLYEDKR+H PGALTDLRSALVNNTIFASLAV+NGFHKY KHLSPGL+EVV RFV IQEENGHTIDEEF F GEDD E+AEDVE PK LGD+FESVAGAIYLDSNMSLD VWKVYHKIMENE++QFSKNVP SP+RELLELEP TAKFSKPEKL DGRRVRV+VEI GKG FKGIGRNYRIAKCTAAKCAL  +KK+
Sbjct:   60 KSEKRKWTLLVLEEAEVDQYMFSIRHLTDLKPLEIRSVDHSDFINYDVIVTTENLCLEIFEKNCLHFDQLSLAIFNNCQKIIVENSTYFKICNFIKSNSQCRILGIVHPLFELDSDPLFIENQLKFISHKLFSSIETASDIVSLLRSCCKPKEVLIECAVQSEDFPNIGIKSIVQSLTDFLNDHNYNPENIYGDDEELREELKKIPCPKNVPLQMISEFSDVLKTMGPYCADKVALTLLYRIENLKVKTPYERHYALLCIVSTLLIQIRAKFDNIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFNSNNNLAEVCKDQEGNKDKIIKSKSAKRNCKLTRRYYNKTHRKQRQSRDPCEENVCAIILVNSKMTASVLYHLFLDLKNSNEEDFGWIEPQYMVDNNADPITEPEEFEIERKTQENILKRFRQRNCNVLIGTKELETGINLPRCNLVINYNLPLSYKSYLMSKSKARTLDAYYVLMFDEHATSKILSCCQLYKDINQMLLSHCTLKDIDMEKEIYADRFNWFVSPFKPGKKEDSAFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSIVYENQPMFVCSIRLPINSPIKHEIHGHPMPCEILAKRIAALEVCRQIYSQGQLDDTLQPITKESFHALFNTDEIIPDTEDSLITCKTKDSMPGTYKRRQHYYKRTAEALNDCRPVEGKPCHLYAILLNITCPIPEQENTKSRRIHPPEESIHGFGILTTKHIPSIPAFPIYPRCGEVYVRLKRIKTDMFLTQHQLDNIATFLNYTFSNVLCFKKCRVEFNPTTTHNCYYIVPTLRDASGSIDVDWKILDNVQTFRDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPEYFYVEEICTHLNPKSPFPDPTEKYKTFEDFYYHKYSLKIQNLEQPLLDVDPTSARLNFLTPRYMNCKGEYLPTSSDATKRAKRYDLSHKQILVPELCNIHLFPASMWRDAVSLPSILYRINALLLADEIRTIVAKDTSLGLVNLSFDHIWKPLDFGWPIKDVLIRRKEQKEISTIKVIEPVETVKRFIDEVEKEEKIDELNDPNWMEIGTWSNDMADFAMNNIDNTTKERYSYPNSLMIQSNSESSTFSDVESDDGIQVN-----------------EVKSSSNIDSSSLL-----KLP--WELNSNTGYGLSDINILLNNTS----FMPEDDKCIKNEIYKNNKTIDSIN-------------------------------EVNDLQTETF--------------------SFDFQPDLNYHPGPSPSILLQALTTANAIDGYDLERLETIGDSFLKYAVTAYLYCTHNNVHEGILSDLRSNHVSNLNLYRLGKLKMFGERMISTKFEPRSNWLPPCYIGPHKLEKAVINSNIS-----------------------------------------------ITQHITNDKSIADCVEALIGAYLISCGTRGALLFMSWLGITVLNTLDDSKLGYLKLPPSPLLRNVNDPEGELTKLMDGFESFEQHLGYYFQDRSYLLQAMTHASYYPNCLTDCYQRLEFLGDAVLDYLITRHLYEDKRRHPPGALTDLRSALVNNTIFASLAVKNGFHKYLKHLSPGLSEVVYRFVAIQEENGHTIDEEFCFSGEDDFEDAEDVEAPKVLGDIFESVAGAIYLDSNMSLDAVWKVYHKIMENEIKQFSKNVPISPVRELLELEPNTAKFSKPEKLVDGRRVRVIVEILGKGVFKGIGRNYRIAKCTAAKCALNQIKKR 1714          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|1188455732|dbj|BAX36480.1| (Dicer1 [Planococcus kraunhiae])

HSP 1 Score: 1774.6 bits (4595), Expect = 0.000e+0
Identity = 960/1914 (50.16%), Postives = 1259/1914 (65.78%), Query Frame = 0
Query:    2 KSEKRKWTLLVLEET-EIDQYMFSIGHLTDLK-------PLDIRSVNHLDFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEF-DSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPK-----SFKADSNNVEVCKDQKEKKDR------------------------TIKSKSIRRNWKLARRYG----------THRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIF-ADRYNWCVTPFKP-GKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIK---------------------------VAEPVETVKQLVDEKIKEEK----IDKSDDPNWMDIGTWSNDMA--------DFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGL-----HSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLL--------------KLPWELNANTGYGLSDINVLSDKT------------SFIPED-----DNDIKSEIFIK-NKTFDSVNKVHGVQSE---TFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPL-FVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDS------KLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKK 1779
            +S+KRK+TL   E       Y  +I HLTDL        P+    V        +VI+T  +   EL    ++  D + L I ++C     ++   + +   +      RI G+++PL+   D +P  IE  L  +   +   +ETASDIVSILR+ CKP E L EC    +D  +  I   VQ   EFL +H Y+P+ IY  D +  EELK +P+P  EPL +I DFL++L TMG +CA+KAAL+ L+++EKLK+KTPYERH++LLC+VS+L+++IR  F+D F  Y+  ++V  F SP++ R++  L Q+KP           +NN     D+K  +D                         TI    IR     A R+            + +Q  S D   E +C +I V +++ A++++YL  DLK  + ++F W+ PQ+T +K ADP  EP++ EI+H+  E+ LR+FR RECN+LIGT +LE GID P+CNLVI ++ P S++SY+ SKS+A   +A++ LM++       ++ L  Y +I Q+LL  C    I+ E EI  AD+Y+  V  + P G +EDSP+V +  A+  +NRYCAKLPSD+FT+L+P+W I+++VY  + M+V ++RLPINSP K +I GHPMP EIL+KRIAALE CR LH  GELD+ LQPI KESFH LF+A++++ D  D +   +  + RPGTNKRRQYY ++IA    DCRP+     +LYAI + ++CP+PEEQNTRGRRIHPPEES  GFGIL  K IP + PFPI+TRCGEV VSL+     ++L+  QL+ I+TFLNYTFT VLRL K  +AFD   +   Y+I+PTLR  +  I IDW FL  +++ K+ +L I+ +E+R +F+   E+  DAVV P YRNQ+ PQ+FYVAEICT+L PKS FPG  + YKTFE+YY+ KY+LKIQNL+QPLLDVDHTSARLNFLTPRY+NRKGV LPT S+ATK+AKR++L QKQILVPELC +HLFPAS+WRKAV+LPCILYR+N LL+A+EIR +V+++I+LGL  +  D  W  LDFGWT+ DV+ + +E KE   +K                                   K+  D+  ++EK    +  SD    M+IGTWSN+MA        +F      S   +RY SPTSW+  +D+      DLD +             + +G+RIEF++ +LAEAVD  +   +      N +T   W W+D+ H +   N   + K+  D      + I+ +  +  S+   +L                 KLPW L  +TGYG+ D+++  D T            +  P D     D +  + + +  NK   +VN+V     E   TFSFD+QPDL NH GPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAIT YLYCT+DNVHEGKLSH+RSKQVSNL+LY+LGK K+FGE M++ KFEPHDNWLPPC+ +P ++EKALI   I +    +  L +    + KE +    +     ++ED+ N  L ++P++L+T HSIPDKSIADCVEALIGAYLISCG RGA+LFMSWLGIKVLP  H++      + GYL PP SP +RNV +PE EL +L+ G++ FE+ LGY+F DRSYLLQAMTHASY PNR+TDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFA+LA+R GFHKYF+HLSPGLA+V+ RFV IQE+N H I EE+Y + E++CEE EDVEVPKALGD+FESVAGAI+LDS MSLD VW VYHKIM NE+E FS NVPKSPIRELLELEPETAKF +PEKLADGRRVRV VE+FGKG FKGIGRNYRIAKCTAAKCALK LKK+
Sbjct:   59 RSKKRKFTLFTSESVPNAVHYASAIKHLTDLHLVDFIQFPISSDKVTDEVIAQAQVIMTNSSQAWELISNDFISLDDIFLLIVDDCHFSTLKSHPLHNLMKSVASKDSIRIFGMIYPLYTISDLNPGKIEADLNELQEVMHCRVETASDIVSILRYNCKPTEFLCECDTRKKDGLDEIILGEVQDTVEFLKEHRYDPSEIY--DGDLLEELKAVPDPTEEPLNIIRDFLDVLNTMGAWCANKAALSSLFIIEKLKLKTPYERHFLLLCVVSSLMLRIRTIFEDYFSQYTEKEQVYNFVSPKMKRLVEILLQYKPSKRIIPESNQSTNNTVGENDEKNAQDNNLNKENIPTNQNENSETLEQPTPLTICDSYIRYKNDKANRWKNKKKFQNKQLNNNRQKSSVDE-SEIICCVIFVKSRLIATVIHYLLSDLKKFDNDNFWWLSPQFTTEKTADPEKEPRDAEIQHRNLEDVLRKFRTRECNILIGTSMLEEGIDFPKCNLVIGFDPPTSFRSYIYSKSKASANNANFFLMYELPFKEKFINDLAKYYEIEQLLLKRC-FNKIEKEDEISEADQYSSAVISYSPPGTEEDSPYVCLDNAVSCINRYCAKLPSDSFTRLTPMWTIKTIVYNKKQMYVTTLRLPINSPYKKEIIGHPMPTEILSKRIAALEACRLLHQSGELDNNLQPIGKESFHLLFSAEDIVLDESDLIPLTENADARPGTNKRRQYYKRKIAYCLMDCRPMPSVPMYLYAIKMILSCPLPEEQNTRGRRIHPPEESPQGFGILLTKKIPKVCPFPIFTRCGEVIVSLELCSNTVYLSTEQLEIISTFLNYTFTKVLRLNKYFMAFDSLNSPCTYFIIPTLRTPNSEIVIDWDFLHQINQLKEEELKIVPDEERKNFKFCKELYADAVVMPSYRNQDFPQHFYVAEICTNLTPKSKFPG--DEYKTFEEYYFRKYQLKIQNLDQPLLDVDHTSARLNFLTPRYVNRKGVALPTCSEATKKAKRESLEQKQILVPELCQIHLFPASLWRKAVALPCILYRLNCLLIAEEIRYVVSREINLGLNVVPEDFQWPFLDFGWTLADVVKRTRELKEQKALKENSKLPLKLTEIEENVINEEPPPEEIEAEIETNDTKEDSDKPEEKEKDGNSLTSSDGEPLMEIGTWSNEMANDIQTYSTEFENTFAQSCNSIRYGSPTSWLNHNDD------DLDGESISDSISSDDSFENPSGIRIEFKSEFLAEAVDRMEECAD---LDDNFDTENTWQWDDSDHLMD--NVGAEIKRFEDSVTTNKNKILTSGRIYDSSRPLALKPFESNSFQKTSKVESKKLPWILTPDTGYGIPDVDLNPDSTDSGISVSSQGSENISPADSCSYDDGESGNGLCVALNKC--NVNEVSNDMIEVIDTFSFDYQPDLINHVGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITNYLYCTYDNVHEGKLSHIRSKQVSNLHLYKLGKKKIFGECMVACKFEPHDNWLPPCFRIPVEVEKALIEHKISSCFLKVGDLSSLW--SVKEDDVSFNKKTKDDIHEDEVNDALNYLPFHLITYHSIPDKSIADCVEALIGAYLISCGIRGAMLFMSWLGIKVLPVTHNADENGPTEYGYLNPPPSPLIRNVPNPEEELERLLVGYDEFERILGYNFNDRSYLLQAMTHASYSPNRITDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFAALAIRFGFHKYFRHLSPGLADVIHRFVRIQEDNNHAIFEEYYLITEEECEEVEDVEVPKALGDIFESVAGAIFLDSGMSLDAVWSVYHKIMRNEIELFSTNVPKSPIRELLELEPETAKFGRPEKLADGRRVRVTVEVFGKGTFKGIGRNYRIAKCTAAKCALKQLKKR 1951          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|1080067670|ref|XP_018576096.1| (endoribonuclease Dcr-1 [Anoplophora glabripennis])

HSP 1 Score: 1723.37 bits (4462), Expect = 0.000e+0
Identity = 928/1820 (50.99%), Postives = 1226/1820 (67.36%), Query Frame = 0
Query:    1 MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDI-RSVNHLDFI-----NYEVIITTENLCLELFEKKYLRFD--QLNLAIFNNCQKIIQENSTYYK-ICNFIK--PNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPM---FVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHAL------FNADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEPVETVKQLVDEKIKEEKI---------------------DKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKK 1779
            M+    K  L +L+   +      + +LTDL  + I +S+  ++ I     NY+VIITT  + +E+  ++ +  D    NL + ++C  +     T+ K I N  +  P  K RILG+   L   +  P  +E +L+ +   L  S++T+S+IV+++R  C+P+E +IEC+   +   ++ IK++V     FL +H Y+P+ IY  D+E  EELK++PNPK+ PLQ++ DFLEIL+ +GP+ ADKAAL +L  +EKLKVK PYERHY+LLC++S+ L+ +RA  D  F    + +++ ++S+P+VL+ I  LKQFKP   K +S          EK   T    + R   K +RR    R Q       EE +CA+I V+N+  A  ++ L   L  ++ +DF W+   ++V+K ADPI EP+E E EHK QEE LR+FR  ECN+L+ T +LE G DLP+CNLVI +++P ++ SY++SK+RA+  DA+YIL  +ED   + +S L  Y ++   LL  C+  + D E+E+ AD Y+ C  P++P  +  +P V +  AI L+N+YCAKLPSDTFT+L+P+W      YE + +    +C IRLPINSP+K  +   PMP  +LA+R AA  +C+ LH   ELDD LQPI KE+F A       F  DE  PD E++ I       RPGT KRRQYYYKRIA+A  +C PV G+  + Y I++ + CP+PEEQNTRGRRI+PPEES  GFGILT K IP I  FPI+TR GEV V L+ I   + L   Q+  I  F+NYTFT+VLRLQK  + F+P  + N Y IVPTL +  G +++DW+F+D + +       II ++DR  +  + E  +DAVV PWYRNQ+QPQYFYVAEIC +LNP S FPGS   Y TFE+YY  KY ++IQ+L Q LLDVDHTSARLNFLTPRY+NRKGV LPTSS+ TKRAKR+NL QKQILVPELC++H FPAS+WRKAV+LPCILYRINALLLA++IR  VA  ++LG V L  D  W  L+FGW++ DVL   K+ +E    K  E ++ ++Q  +EK++E KI                     + S+D  W++IGTW N+MA+   + + ++  VRY+SPTSW+   DN    FSD DSD  I+ +G    GLRIEF   + AEAV+++  +  +   F ++     W  +D+        ++  +    +  Y     I++  + +   N +         + +  T     D N+L     FI    N+IK+    + K  + VN     ++ TFSFD QP+L  HPGPSP+VLLQALTMSNANDGINLERLETIGDSFLKYAIT YLY  ++NVHEGKLSHLRSKQVSNLNLYRLGK K  GE MI+TKF+PHDNWLPPC++VP +LE+ALI A  P   W +  +   ++ T  +I  ++++   G+      + P  +PYNLVTQHSIPDKSIADCVEA+IGAYLI CG RGALLFM+WLGI+VLP + D   G ++ P SP LR++ DPEGEL +L+DG++ FE+H+GY F+DRSYLLQA+THASY PN+LTDCYQRLEFLGDAVLDYLITRHLYED R HSPGALTDLRSALVNNTIFASLAVRNGFHKYF+HLSPGL EVV +F+ +QEE+GH++ +E Y + E +CEE EDVEVPKALGDVFESVAGAI+LDS MSLD VWKVY+K+M+ E+EQFS  VPKSPIRELLELEPETAKF KPEKLADGRRVRV VE+FGKG FKGIGRNYRIAKCTAAKCALKHLK++
Sbjct:   57 MRKIPSKRALFILDLQNVPIMTCHVKYLTDLNVVSITKSIEEIEHIKEYLNNYQVIITTAEISVEILSREDVIEDLAYFNLLVIDDC--LYGHRQTFIKFIMNKYRNLPKDKPRILGLTTGLLGLELQPDRLEAELRRLEKLLNCSVDTSSEIVTLIRLSCRPRENIIECSRFQQFDLHLSIKSIVNYSKLFLLEHRYDPSEIY--DDELLEELKEVPNPKDTPLQLLNDFLEILEDLGPWGADKAALHILSKIEKLKVKVPYERHYLLLCMISSTLVTVRAACDYEFEKLDDPERLRQYSTPKVLKFIEILKQFKPPGEKPNS---------AEKVTETDIPTNARGKSKTSRRSFVSRPQS------EEILCALIFVHNRYKAKAIFALLCALSQTD-DDFWWVSTLFSVEKVADPIREPREAEHEHKTQEEVLRKFRCHECNILVTTSLLEQGCDLPKCNLVIRFDLPKTFHSYIQSKARARATDAYYILFANEDEIPSFVSNLAEYNEVENTLLKRCSSLEPDKEEELLADAYSTCCKPYQPLPEYGAPCVTLENAIPLLNKYCAKLPSDTFTRLTPLW------YEEKDLSGQCICHIRLPINSPVKQTVTSPPMPNSLLARRAAAFMLCQLLHKTKELDDYLQPINKENFRATEDDWNNFTLDE--PDDENSDI-------RPGTTKRRQYYYKRIADALLNCHPVAGQPTYFYKIIMTLTCPLPEEQNTRGRRIYPPEESPQGFGILTSKEIPKISAFPIFTRSGEVCVDLELISQSIVLNNDQIKRIREFVNYTFTSVLRLQKYLMLFNPDASSNNYLIVPTL-NADGGVEVDWQFVDLIFENLTTVPVIIPDDDRKSYVFNAEEYRDAVVMPWYRNQDQPQYFYVAEICHNLNPTSAFPGS--EYATFEEYYLRKYGIQIQSLTQNLLDVDHTSARLNFLTPRYVNRKGVALPTSSEETKRAKRENLEQKQILVPELCSIHPFPASLWRKAVALPCILYRINALLLANQIRETVAFALNLGKVKLPEDFKWPSLNFGWSLSDVL---KKSREDELKKQEEKLKLLEQRAEEKLQELKITEISDDMKTEQTESPLEESEDENSNDEKWIEIGTWCNEMAE-VTDTVGTSAVVRYASPTSWL-NLDNIYDDFSDTDSDLTIEDSGSEWGGLRIEFTGDHQAEAVEDDHDEDKEFYLFDDSNA---WKIDDDSELTEALRTDFHEACAKNKEYILSSGILVRSDCEFQRNPNR----NHTEQKSIKTSLDSFDFNIL-----FI----NEIKAPRSFEIKYTEYVNDYDISETLTFSFDRQPNLEEHPGPSPNVLLQALTMSNANDGINLERLETIGDSFLKYAITNYLYAKYENVHEGKLSHLRSKQVSNLNLYRLGKRKGLGEFMIATKFDPHDNWLPPCFYVPKELEEALIDAQFPANCWTVADMAATRNMTLDDICSMVRERGEGY------SLPNVIPYNLVTQHSIPDKSIADCVEAVIGAYLIECGPRGALLFMAWLGIRVLPKIDDGSYGEVELPRSPLLRHIADPEGELERLLDGYDKFERHIGYKFRDRSYLLQALTHASYSPNQLTDCYQRLEFLGDAVLDYLITRHLYEDPRMHSPGALTDLRSALVNNTIFASLAVRNGFHKYFRHLSPGLNEVVEKFIRLQEESGHSLVDELYLMVETECEEVEDVEVPKALGDVFESVAGAIFLDSGMSLDAVWKVYYKMMKTEIEQFSNKVPKSPIRELLELEPETAKFGKPEKLADGRRVRVTVEVFGKGLFKGIGRNYRIAKCTAAKCALKHLKRR 1811          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|1321100772|gb|AUM60045.1| (dicer 1 [Diabrotica virgifera virgifera])

HSP 1 Score: 1716.82 bits (4445), Expect = 0.000e+0
Identity = 924/1831 (50.46%), Postives = 1226/1831 (66.96%), Query Frame = 0
Query:    1 MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLK-------PLDIRSVNHLDFIN-YEVIITTENLCLELFEKKYLR-FDQLNLAIFNNC-----QKIIQENSTYYKICN-FIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRKQGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFN--ADEVLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIK------RKEQKEISTI--KVAEPVE--TVKQLVDEKIKEEKIDKSDD----------------PNWMDIGTWSNDMADFAMNNIDSTTKVRYSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAVDENDSKTNKLLFFQNNETPQLWTWN-DNGHSVTEYNSNQQDKQIIDLFYKK--DDDIIINREVK----SSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDK--ENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDSKLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKKK 1779
            M+ +  K  L +L+   +      I +LTDL         LD +    LD+   Y+VI +T  +C+E+ ++  +  F   NL + ++C     Q +I+    YY+    F +P    RILG+   L   +  P  +E +L+ +   L S ++T+S+IV+++R CC+P E LIEC  +  D    +IK +++   EFL DH Y+P+ IY DD    EELKQ+P+P+  PL+++ +FLEILK +GP+ ADKAAL +L  +EKLKVK PYERHY+LLC+VS+ L+ +RA  D +F +Y  ++++ KFSSP+VL+ I+ LKQFKP   K   +  ++ KD++E     IK +      K  RR    R Q       E+ +C ++ V+N+  A  L+ L   L N + +D  WI   ++V+K AD  +E ++ E EHK QEE LR+FR  ECN+L+ T VLE G DLP+CNLVI +++P ++ SY++SK+RA+  +AHYIL  +E      +  L  Y ++   LL  C   + +  +E+ AD YN    P++P  +E +P + +  AI L+N+YCAKLPSDTFT+L+PIW        N   F+C +RLPINSP+K  I   PM   +LA+R AA  +C+ LH   ELDD LQPI+KE+F A  +   +  L +++D     +T E RPGT KRRQYYYKRI+EA  +C PV G+    Y I++ + CP+PEEQNTRGR+I+PPE+S+ GFGILT K IP I  FPI+TR GEV V L+ I TD+ L++ Q++    F+NYTFT+VLRLQK  + F+P  + N Y IVPT++D +  + + W F+D +          I +E R+ ++   E   DAVV PWYRNQ+QPQYFYVAEIC++LNP S FPGS   Y TFE+YY  KY ++IQNL Q LLDVDHTSARLNFLTPRY+NRKGV LPTSS+ TKRAKR+NL QKQILVPELC +H FP S+WRKAV+LPCILYRINALLLAD+IR  VA+ + LG  NLS D  W  L+FGW++ DVL K      RK+Q+ ++ +  KV E ++  T++++  ++  E   D S+D                  W++IGTW N+MA     + +++  VRY+SPTSWM   D     FSD +SD   + +       RIEF   + AEAVD+ + + +      N+++     W  D  + +TE N  ++     D   K      I+I R+      SS + + +++   P          +++I++     + I +  +DI     ++ + F+  +K   +   +FSFD QP+L  HPGPSP+VLLQALTMSNANDGINLERLETIGDSFLKYAIT YLY  ++NVHEGKLSHLRSKQVSNLNLYRLG+ K  GE MI+TKF+PHDNWLPPC++VP +LE+ALI A  P   W++  +   ++ +  +I  ++++   G+        + P+ +PYNLVTQHSIPDKSIADCVEA+IGAYLI CG RGALLFM+WLGI+VLP L D   G +KPP SP LR+V DPEGELT+L+DG++ FE+H+GY F DRSYLLQAMTHASY+PN LTDCYQRLEFLGDAVLDYLITRHLYED R HSPGALTDLRSALVNNTIFASLAVRN FHKYF+HLSPGL EVV RF+ +QEE+GH++ EE Y + E +CEE EDVEVPKALGDVFESVAGAI+LDS MSLD VWKVY+K+M+ E+EQFS  VPKSPIRELLELEPETAKF KPEKLADGRRVRV VE+FGKG FKGIGRNYRIAKCTAAKCALKHLK++
Sbjct:   57 MRIKNGKKALFILDPQNVPIMTSHIKYLTDLNCISIMEYTLDAKENGILDYFEPYQVITSTAEICVEMLKQSIISDFSAFNLFVIDDCLYGPRQSLIEIIMKYYRSSPVFNRP----RILGLTTGLLSSELQPDRLEGELRRLEKLLNSDVDTSSEIVTLIRLCCRPHETLIECPKNEPDSLYDEIKNIIKMAIEFLKDHRYDPSEIYEDD--LLEELKQVPDPRTVPLELLEEFLEILKDLGPWGADKAALNILSKIEKLKVKIPYERHYLLLCMVSSALVTVRAVCDYVFESYDELERINKFSSPKVLKFIDVLKQFKPPGEKPQPS--QLIKDKEETSPVKIKCRG-----KGPRRPLFPRPQN------EDNLCCLVFVHNRYKAKSLFALLCSLSNVH-DDLWWISALFSVEKVADSRSEARQAENEHKTQEEVLRKFRCHECNILVSTSVLEQGCDLPKCNLVIRFDLPNTFYSYIQSKARARAPEAHYILFGNEQELDKFVDNLAEYNEVENTLLRRCYSLEPNKNEEMVADMYNNLCKPYQPLSEEGAPSITLINAISLLNKYCAKLPSDTFTRLTPIWSEDKT---NDGKFICHLRLPINSPVKKTISSPPMTNGLLARRAAAFMICQLLHMTKELDDYLQPISKENFRATEDDWVNFALDESDD-----ETSEVRPGTTKRRQYYYKRISEALLNCHPVAGQPTFFYKIMMTLTCPLPEEQNTRGRKIYPPEDSLQGFGILTSKRIPKISAFPIFTRSGEVSVDLELISTDVVLSESQIEKTREFVNYTFTSVLRLQKYLMLFNPEASPNNYLIVPTIKDDAQSVRVHWDFIDLIFNNLTTTPEFIVDEKRVDYEFKAEAYSDAVVMPWYRNQDQPQYFYVAEICSNLNPTSAFPGS--EYATFEEYYNRKYGIQIQNLNQNLLDVDHTSARLNFLTPRYVNRKGVALPTSSEETKRAKRENLEQKQILVPELCAIHPFPGSLWRKAVALPCILYRINALLLADQIRRTVAEALRLGKSNLSEDFKWPSLNFGWSLSDVLKKSREEELRKKQENLAALETKVTEKLQTLTIREIKSDEDPESIDDCSNDDTKLETYISDSNNEGESKWIEIGTWCNEMA--GSTDPENSAVVRYASPTSWM-AVDTNYEDFSDSESDMYDEDSDTELGPFRIEFTGDHQAEAVDDEEDEEDSSFKLYNDDS----VWQIDEENELTE-NLKKEFHAACDKNKKHILSSGILIKRDSTFSKHSSRDKEGVTVFLNPI---------VNNIDLSGLYMTPIEQQMDDI-----LELEYFNEYDKSEPL---SFSFDKQPNLEEHPGPSPNVLLQALTMSNANDGINLERLETIGDSFLKYAITNYLYSKYENVHEGKLSHLRSKQVSNLNLYRLGRRKYLGEFMIATKFDPHDNWLPPCFYVPKQLEEALIDAQYPANCWSVADMAATRNMSLDDICLMVRERAEGYTLTSNLLSDGPMAIPYNLVTQHSIPDKSIADCVEAVIGAYLIECGPRGALLFMAWLGIRVLPRLPDDGYGEIKPPRSPLLRHVHDPEGELTRLLDGYDKFERHIGYKFADRSYLLQAMTHASYFPNHLTDCYQRLEFLGDAVLDYLITRHLYEDPRMHSPGALTDLRSALVNNTIFASLAVRNNFHKYFRHLSPGLNEVVERFIRLQEESGHSLVEELYLVVETECEEIEDVEVPKALGDVFESVAGAIFLDSGMSLDAVWKVYYKMMKPEIEQFSNKVPKSPIRELLELEPETAKFGKPEKLADGRRVRVTVEVFGKGLFKGIGRNYRIAKCTAAKCALKHLKRR 1832          
BLAST of XM_015507628.1 vs. GenBank_protein
Match: gi|1000768133|ref|XP_015607218.1| (PREDICTED: endoribonuclease Dcr-1 isoform X2 [Cephus cinctus])

HSP 1 Score: 1714.89 bits (4440), Expect = 0.000e+0
Identity = 941/1884 (49.95%), Postives = 1229/1884 (65.23%), Query Frame = 0
Query:   43 DFINYEVIITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNSKCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCCKPKEVLIECA------IHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFGEELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKTPYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINTLKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKS------IRRNWKLARRYGTH---RKQGRSRDPYE----------ETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYTVDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPRCNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYKDINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAIGLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHDIHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADEV--LPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLYAILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTRCGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTTTHNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPDIEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDYYYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKRAKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIRTIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIK---VAEPVETVKQLVDEKIKE-----------------------EKIDKSDDPNWMDIGTWSNDMA----DFAMNNIDST-------------TKVRYSSPTSWM----IQSDNESST----FSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAV-DEN-------DSKTNKLLFFQNNETPQLWTWNDN-------GHSVTEYN-SNQQDKQIID--LFYKKDDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIPEDDNDIKSEIFIKNKTFDSVNKVHGVQSET-------FSFDFQPDLNNHPGPSPSVLLQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLRSKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALISASIPTTLWNMITLPTFK--DPTD-----KEIEEVIQQFKVGF------LNEDKENTPLFVPYNLVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPT-----LHDS---------------------------KLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQAMTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLRSALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEEFYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKIMENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFGKGEFKGIGRNYRIAKCTAAKCALKHLKK 1778
            DF N  V++TT ++C  L + + +   Q+NL + + C   +++      +  F+   +  RI+G+  PLF    +P  +  +++ + +     +ETASDI+SILR+  KPKE ++E        +H E L N  +  M     EFL DH Y+P  IY  +EEF E++++IP+P ++P +MI DFL +L+T+GP+CAD+AAL LL + EKLKVKTPYERHY+L  +V+++ I+IRA  +  F   S  +++ +FS P+V R++  LK + P   K DS+N+    D K   D  +K++S      IR N    R++G++    ++G  R P            + +C +I V+   TA IL+YL L+    + +D  ++ P YT++K  D ++  ++ E+EH+KQEE L+RFR  ECN+LI T +LE GID+P+CN V+ Y+ P SY+SY++ KSRA+  DA ++L+  E  +   + RL  Y  I ++LL  C+ K+   E+E+ AD+Y   +  +KP   +D+P V   +AI LVNRYCAKLPSDTFT+L+P W I +V  +N  M++CS+RLPINSP+K+ +  +PMP   +A+R+AAL++C +LH + E+DD L PI KE+F A     EV  LPD   A    D  E RPGT KRRQYYYK+ AEA  DCRP+ G   +LY I + ++CP+PEEQNTRGRRI+PPEES  GFGILT+K IP + PFPIYTR GEV+V LK  K  + L + Q++ +A FLNYTFTNVLRLQK  + FDP  + N Y IVP   +    +++DW FLD ++K ++   + +  +DR +F+ D     DAV+ PWYRNQ+QPQYFYVAEIC +LNPKS FPG+  +Y TFE+YY  KY ++IQNL QPLLDVDHTSARLNFLTPRY+NRKGV LPTSS+ TKRAKR+NL QKQILV ELC +H FPAS+WR+AV LPCILYRINALLLA++IR  VA+ I+LG V+L+ +  W PLDFGW++ +VL K KE ++ +  K   V   ++  K  + +KI+                        E+I++S D N ++IGTWSN+MA    +F   NI S                +RY SP         +SD+  S     FSD   D+        S GLRI +    +AEAV DEN       + K   LL  + +     WT  +N        H  T Y  + +++++IID   F    D+I I R+   +   D     K P     N  Y           T +I +   + K+E+  K      V K     + T       FSFD+QP+L  HPGPSPS++LQALTMSNANDGINLERLETIGDSFLKYAIT YLYCT+DN+HEGKLSHLRSKQVSNLNLYRLG+ KM GE MI+TKFEPHDNWLPPCY+VP +LE+ALI + +P+TLWN   +P  +  +PTD     +E E  +   ++        L  D +    F+PYNL+TQHSIPDKSIADCVEALIGAYLI+CG RGALLFM+WLGI VLPT       D+                           + G L+ P  P LR+  DPE EL  ++DG+   E+++GY FQD SYLLQA THASY PNRLTDCYQRLEFLGDAVLDYLITRHLYED RQHSPGALTDLRSALVNNTIFASLAVR GFHKYF+HLSPGL+ V+ RFV IQEENGH+I EE+Y +GE++CEEAEDVEVPKALGDVFES+AGAIYLDS MSLD VW VY++IM++E+EQFS NVPKSPIRELLELEPETAKF KPEKLADGRRVRV V++FGKG FKGIGRNYRIAKCTAAKCALK LK+
Sbjct:  107 DFTNTNVLVTTSDVCAHLLQVQNILPSQINLVVVDQCHASLKDGDLNIVLQTFLSCKNGPRIIGLAVPLFNLTEEPGVLGLEIEKVENTFYCEVETASDILSILRYSPKPKEYIVEYKDGEKGNLH-EALENCAVHAM-----EFLRDHRYDPTEIY--NEEFLEDIQKIPDPTDKPCEMIEDFLYVLRTLGPWCADRAALALLILTEKLKVKTPYERHYLLFNVVASVFIKIRALCESEFEGLSERERIYQFSMPKVHRLLKILKTYTPFHSK-DSHNI----DNKANNDANVKTESNKELIPIRENHMHFRKFGSNWRPHEEGYKRSPKSLRHLRSVTDPDLLCGVIFVDRAFTAKILFYL-LNEVCKHDQDLHFLSPLYTIEKTVDDMSYARDVEMEHRKQEEVLKRFRIHECNLLIATSILEEGIDIPKCNFVMRYDFPKSYQSYVQCKSRARAIDALHVLLVPEKESKICVWRLAQYHYIEKILLTKCSNKEPTEEEELEADKYAAMIPQYKPLDVDDAPSVSFNSAISLVNRYCAKLPSDTFTRLTPEWFIDTVDIDNTIMYICSLRLPINSPVKYVVSSYPMPNRAMARRLAALQLCVKLHRENEIDDNLLPIGKENFKAKPEDAEVPALPDESKA----DFSEARPGTTKRRQYYYKKTAEALTDCRPIIGVPSYLYHINMMLSCPLPEEQNTRGRRIYPPEESAIGFGILTLKEIPKLCPFPIYTRSGEVHVKLKLSKETVILDEVQIERVAAFLNYTFTNVLRLQKYLMLFDPNASENSYIIVPVKTENGPDVNVDWDFLDCIYKNRNTVPNQVPEKDRKYFKFDPSKYHDAVIMPWYRNQDQPQYFYVAEICGNLNPKSSFPGA--DYSTFEEYYLKKYNIQIQNLNQPLLDVDHTSARLNFLTPRYVNRKGVALPTSSEETKRAKRENLEQKQILVAELCAIHPFPASLWRQAVCLPCILYRINALLLANQIRCQVARTINLGQVHLNSNFEWPPLDFGWSLAEVLKKSKETEKANESKNEAVRNNIDVDKSSISDKIENKLAYDKDSLDESAISKETIDPELEEIEESKD-NELEIGTWSNEMAMNSMEFNSENIKSFPMNLTVLQPDFSWNDIRYGSPACDSDLDGYESDDTCSEGLIDFSDESEDE--------SRGLRIAYMGENVAEAVEDENQICKREINKKILDLLEVERSSDENTWTCLENMNDSLLEKHKATHYEFAQKKEREIIDNGSFISGSDEITIKRKNSLNNQADG----KEP-----NAKY-----------TEYIAKVVENFKNEVLKKKHEVAPVKKRPSTSALTFHKEESLFSFDYQPELKGHPGPSPSLILQALTMSNANDGINLERLETIGDSFLKYAITTYLYCTYDNIHEGKLSHLRSKQVSNLNLYRLGRQKMLGESMIATKFEPHDNWLPPCYYVPRELEQALIESGVPSTLWNQADIPALQAVNPTDITQLVRETEHKLGIMRIELDKNESCLTNDLDTFRCFIPYNLITQHSIPDKSIADCVEALIGAYLIACGPRGALLFMAWLGIHVLPTEEVCIFQDTEPVERYPGSTPYVKRINEYGKTIWTQIRYGKLEEPQYPLLRHTPDPERELKTMLDGYNQLEENIGYKFQDTSYLLQAFTHASYQPNRLTDCYQRLEFLGDAVLDYLITRHLYEDSRQHSPGALTDLRSALVNNTIFASLAVRCGFHKYFRHLSPGLSVVIDRFVRIQEENGHSISEEYYLIGEEECEEAEDVEVPKALGDVFESLAGAIYLDSGMSLDAVWSVYYRIMKSEIEQFSTNVPKSPIRELLELEPETAKFGKPEKLADGRRVRVTVDVFGKGSFKGIGRNYRIAKCTAAKCALKKLKR 1941          
The following BLAST results are available for this feature:
BLAST of XM_015507628.1 vs. GenBank_protein
Analysis Date: 2018-05-22 (Blastp: NCBI Gnomon 20160302 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|985391716|ref|XP_015363114.1|0.000e+099.89PREDICTED: endoribonuclease Dcr-1 isoform X2 [Diur... [more]
gi|985391714|ref|XP_015363113.1|0.000e+099.89PREDICTED: endoribonuclease Dcr-1 isoform X1 [Diur... [more]
gi|985391718|ref|XP_015363115.1|0.000e+099.89PREDICTED: endoribonuclease Dcr-1 isoform X3 [Diur... [more]
gi|1229879669|ref|XP_022183763.1|0.000e+094.70endoribonuclease Dcr-1 [Myzus persicae] >gi|122987... [more]
gi|328716579|ref|XP_001944314.2|0.000e+095.00PREDICTED: endoribonuclease Dcr-1 [Acyrthosiphon p... [more]
gi|1028720528|ref|XP_016663133.1|0.000e+075.07PREDICTED: endoribonuclease Dcr-1-like, partial [A... [more]
gi|1188455732|dbj|BAX36480.1|0.000e+050.16Dicer1 [Planococcus kraunhiae][more]
gi|1080067670|ref|XP_018576096.1|0.000e+050.99endoribonuclease Dcr-1 [Anoplophora glabripennis][more]
gi|1321100772|gb|AUM60045.1|0.000e+050.46dicer 1 [Diabrotica virgifera virgifera][more]
gi|1000768133|ref|XP_015607218.1|0.000e+049.95PREDICTED: endoribonuclease Dcr-1 isoform X2 [Ceph... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006396 RNA processing
molecular_function GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters
molecular_function GO:0005515 protein binding
molecular_function GO:0004525 ribonuclease III activity
InterPro
Analysis Name: InterProScan on NCBI Gnomon 20160302
Date Performed: 2018-05-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 382..474
e-value: 4.0E-4
score: 29.7
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 415..473
e-value: 5.2E-13
score: 49.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 353..518
score: 11.445
IPR001650Helicase, C-terminalCDDcd00079HELICccoord: 415..473
e-value: 1.38179E-10
score: 58.4033
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 822..995
e-value: 8.6E-42
score: 154.8
IPR003100PAZ domainPFAMPF02170PAZcoord: 828..993
e-value: 4.3E-40
score: 136.6
IPR003100PAZ domainPROSITEPS50821PAZcoord: 852..971
score: 25.312
IPR000999Ribonuclease III domainSMARTSM00535riboneu5coord: 1298..1498
e-value: 4.0E-22
score: 89.5
coord: 1545..1710
e-value: 5.4E-43
score: 158.8
IPR000999Ribonuclease III domainPFAMPF00636Ribonuclease_3coord: 1316..1478
e-value: 3.7E-34
score: 117.4
coord: 1566..1686
e-value: 3.3E-20
score: 72.6
IPR000999Ribonuclease III domainPROSITEPS00517RNASE_3_1coord: 1566..1574
IPR000999Ribonuclease III domainPROSITEPS50142RNASE_3_2coord: 1299..1478
score: 21.951
IPR000999Ribonuclease III domainPROSITEPS50142RNASE_3_2coord: 1530..1687
score: 36.625
IPR000999Ribonuclease III domainCDDcd00593RIBOccoord: 1298..1494
e-value: 2.09915E-23
score: 95.3722
IPR000999Ribonuclease III domainCDDcd00593RIBOccoord: 1545..1710
e-value: 4.34786E-39
score: 140.055
NoneNo IPR availableGENE3D3.30.160.20coord: 1717..1779
e-value: 7.2E-24
score: 85.9
NoneNo IPR availableGENE3D2.170.260.10coord: 836..969
e-value: 8.7E-39
score: 134.1
NoneNo IPR availableGENE3D3.40.50.300coord: 328..505
e-value: 5.8E-23
score: 83.1
NoneNo IPR availablePANTHERPTHR14950:SF37ENDORIBONUCLEASE DICERcoord: 41..1779
NoneNo IPR availablePANTHERPTHR14950HELICASE-RELATEDcoord: 41..1779
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1492..1782
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 255..273
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 274..1469
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..254
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 1470..1491
NoneNo IPR availableCDDcd00048DSRMcoord: 1713..1772
e-value: 3.60872E-4
score: 38.4075
NoneNo IPR availableCDDcd15903Dicer_PBDcoord: 173..277
e-value: 4.01708E-22
score: 90.4226
NoneNo IPR availableSUPERFAMILY54768dsRNA-binding domain-likecoord: 1669..1777
IPR038248Dicer dimerisation domain superfamilyGENE3D3.30.160.380coord: 544..646
e-value: 4.7E-32
score: 111.9
IPR036389Ribonuclease III, endonuclease domain superfamilyGENE3D1.10.1520.10coord: 1523..1716
e-value: 6.0E-81
score: 272.7
IPR036389Ribonuclease III, endonuclease domain superfamilySUPERFAMILY69065RNase III domain-likecoord: 1529..1623
coord: 1661..1709
IPR036389Ribonuclease III, endonuclease domain superfamilySUPERFAMILY69065RNase III domain-likecoord: 1452..1495
coord: 1289..1373
IPR005034Dicer dimerisation domainPFAMPF03368Dicer_dimercoord: 549..640
e-value: 1.5E-27
score: 95.5
IPR005034Dicer dimerisation domainPROSITEPS51327DICER_DSRBFcoord: 549..644
score: 30.466
IPR014720Double-stranded RNA-binding domainPROSITEPS50137DS_RBDcoord: 1712..1778
score: 8.664
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 337..483
coord: 46..118
IPR036085PAZ domain superfamilySUPERFAMILY101690PAZ domaincoord: 840..924

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:692714..707340 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on NCBI Gnomon 201603022018-05-22
Blastp: NCBI Gnomon 20160302 vs NR2018-05-22
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
XM_015507628.1rna3669Diuraphis noxiamRNAJOTR01000065 692291..707460 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>rna3669 ID=rna3669|Name=XM_015507628.1|organism=Diuraphis noxia|type=polypeptide|length=1783bp
MKSEKRKWTLLVLEETEIDQYMFSIGHLTDLKPLDIRSVNHLDFINYEVI
ITTENLCLELFEKKYLRFDQLNLAIFNNCQKIIQENSTYYKICNFIKPNS
KCRILGIVHPLFEFDSDPFFIENQLKFISHKLISSIETASDIVSILRHCC
KPKEVLIECAIHTEDLTNIKIKTMVQSLTEFLNDHNYEPAIIYGDDEEFG
EELKQIPNPKNEPLQMIADFLEILKTMGPYCADKAALTLLYMVEKLKVKT
PYERHYVLLCIVSTLLIQIRATFDDIFYNYSNIDKVLKFSSPRVLRIINT
LKQFKPKSFKADSNNVEVCKDQKEKKDRTIKSKSIRRNWKLARRYGTHRK
QGRSRDPYEETVCAIILVNNKMTASILYYLFLDLKNSNKEDFGWIQPQYT
VDKEADPITEPKEFEIEHKKQEETLRRFRQRECNVLIGTKVLEAGIDLPR
CNLVINYNIPLSYKSYLRSKSRAKTXDAHYILMFDEDATSNILSRLKLYK
DINQMLLNHCTLKDIDMEKEIFADRYNWCVTPFKPGKKEDSPFVDMATAI
GLVNRYCAKLPSDTFTKLSPIWKIQSVVYENQPMFVCSIRLPINSPIKHD
IHGHPMPCEILAKRIAALEVCRQLHSQGELDDTLQPITKESFHALFNADE
VLPDAEDALIPWDTEEPRPGTNKRRQYYYKRIAEAFNDCRPVEGKACHLY
AILLNMNCPVPEEQNTRGRRIHPPEESIHGFGILTMKHIPSIPPFPIYTR
CGEVYVSLKPIKTDMFLTQHQLDNIATFLNYTFTNVLRLQKCHVAFDPTT
THNCYYIVPTLRDTSGLIDIDWKFLDNMHKCKDNKLSIITNEDRIHFQPD
IEVLKDAVVTPWYRNQEQPQYFYVAEICTHLNPKSPFPGSIENYKTFEDY
YYLKYRLKIQNLEQPLLDVDHTSARLNFLTPRYMNRKGVILPTSSDATKR
AKRDNLSQKQILVPELCNVHLFPASMWRKAVSLPCILYRINALLLADEIR
TIVAKDISLGLVNLSFDHMWEPLDFGWTMKDVLIKRKEQKEISTIKVAEP
VETVKQLVDEKIKEEKIDKSDDPNWMDIGTWSNDMADFAMNNIDSTTKVR
YSSPTSWMIQSDNESSTFSDLDSDDGIQVNGLHSNGLRIEFRNTYLAEAV
DENDSKTNKLLFFQNNETPQLWTWNDNGHSVTEYNSNQQDKQIIDLFYKK
DDDIIINREVKSSTNIDSLSLLKLPWELNANTGYGLSDINVLSDKTSFIP
EDDNDIKSEIFIKNKTFDSVNKVHGVQSETFSFDFQPDLNNHPGPSPSVL
LQALTMSNANDGINLERLETIGDSFLKYAITAYLYCTHDNVHEGKLSHLR
SKQVSNLNLYRLGKLKMFGERMISTKFEPHDNWLPPCYFVPHKLEKALIS
ASIPTTLWNMITLPTFKDPTDKEIEEVIQQFKVGFLNEDKENTPLFVPYN
LVTQHSIPDKSIADCVEALIGAYLISCGARGALLFMSWLGIKVLPTLHDS
KLGYLKPPSSPXLRNVDDPEGELTKLMDGFESFEQHLGYHFQDRSYLLQA
MTHASYYPNRLTDCYQRLEFLGDAVLDYLITRHLYEDKRQHSPGALTDLR
SALVNNTIFASLAVRNGFHKYFKHLSPGLAEVVCRFVTIQEENGHTIDEE
FYFLGEDDCEEAEDVEVPKALGDVFESVAGAIYLDSNMSLDTVWKVYHKI
MENEMEQFSKNVPKSPIRELLELEPETAKFSKPEKLADGRRVRVVVEIFG
KGEFKGIGRNYRIAKCTAAKCALKHLKKKIKK.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR003100PAZ_dom
IPR000999RNase_III_dom
IPR038248Dicer_dimer_sf
IPR036389RNase_III_sf
IPR005034Dicer_dimerisation_dom
IPR014720dsRBD_dom
IPR027417P-loop_NTPase
IPR036085PAZ_dom_sf
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0004525ribonuclease III activity
GO:0016891endoribonuclease activity, producing 5'-phosphomonoesters
Vocabulary: Biological Process
TermDefinition
GO:0006396RNA processing