rna3672 (polypeptide) Diuraphis noxia

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameXM_015507631.1
Unique Namerna3672
Typepolypeptide
OrganismDiuraphis noxia (Russian wheat aphid)
Sequence length486
Homology
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|985391722|ref|XP_015363117.1| (PREDICTED: UDP-N-acetylhexosamine pyrophosphorylase [Diuraphis noxia])

HSP 1 Score: 996.112 bits (2574), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 0
Query:    1 MMSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEEISNK 485
            MMSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEEISNK
Sbjct:    1 MMSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEEISNK 485          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|1229879611|ref|XP_022183731.1| (UDP-N-acetylhexosamine pyrophosphorylase [Myzus persicae])

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 446/483 (92.34%), Postives = 461/483 (95.45%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEEISN 484
            MSDFDSIIALLKKYDQEHI+ FWNRL+EKEKEFLL DIRELNIPEVVGMFKK + TM+ NQQKLDN+MNPI AELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFG  KGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIME +NKISKSPDGNGGI+KALRDR VLDEIK LGV+YLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGV+CEVDGKFQVVEYSEITE TAEKRN DGRLTFSAGNICNHFFTTDFLNNVA+KYNS+LKLHVAKKKI YVN +GI+CKPEE NGIKMEKFIFDVFEFCNRLAVWEVER+EEFSALKNAD+PNGKDNPKTARLDVFSLHRKFVEKSGGKF TENIECEISPLLSY GE LKHLVDGK FNS LELKS EEISN
Sbjct:    1 MSDFDSIIALLKKYDQEHIVKFWNRLDEKEKEFLLKDIRELNIPEVVGMFKKTVETMNVNQQKLDNRMNPIPAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGSSKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMEGINKISKSPDGNGGIYKALRDRNVLDEIKRLGVEYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVICEVDGKFQVVEYSEITEKTAEKRNPDGRLTFSAGNICNHFFTTDFLNNVAHKYNSELKLHVAKKKISYVNDDGIICKPEEPNGIKMEKFIFDVFEFCNRLAVWEVERNEEFSALKNADVPNGKDNPKTARLDVFSLHRKFVEKSGGKFTTENIECEISPLLSYCGEGLKHLVDGKSFNSVLELKSVEEISN 483          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|193632108|ref|XP_001944680.1| (PREDICTED: UDP-N-acetylhexosamine pyrophosphorylase [Acyrthosiphon pisum])

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 440/482 (91.29%), Postives = 460/482 (95.44%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEEIS 483
            MSDF+SI ALLKKYDQEHII FWNRL EKEK+FLL+DI ELNIPEVVGMFKK + TM+AN QKLDN+MNPI AELYGAVNRSPKELLIKYEQIGLEQISQG+VGVLLMAGGQGTRLG NYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFG  KGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKI+ME +NKISKSPDGNGGI+KALRDR VLDEIK LGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRN DGRLTFSAGNICNHFFTTDFLN+VA+KYNSKLKLHVAKKKI +VN +GI CKPEE NGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNAD+PNGKDNPKTARLDVFSLHRK+VEKSGG+F T++IECEISPLLSYAGE LKHLVDG+IFNS LELKSAEEIS
Sbjct:    1 MSDFESITALLKKYDQEHIIKFWNRLTEKEKKFLLEDICELNIPEVVGMFKKTVETMNANHQKLDNRMNPIPAELYGAVNRSPKELLIKYEQIGLEQISQGKVGVLLMAGGQGTRLGANYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGSSKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIVMEGINKISKSPDGNGGIYKALRDRNVLDEIKRLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNPDGRLTFSAGNICNHFFTTDFLNSVAHKYNSKLKLHVAKKKISFVNDDGIACKPEEPNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADVPNGKDNPKTARLDVFSLHRKYVEKSGGQFTTDDIECEISPLLSYAGEGLKHLVDGRIFNSLLELKSAEEIS 482          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|1148974633|gb|AQS60688.1| (UDP-N-acetylglucosamine pyrophosphorylase [Sogatella furcifera])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 306/481 (63.62%), Postives = 381/481 (79.21%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKF-ITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEE 481
            MSD   I +LL K+DQ HI+ FW+RL++ E+E L  D+RE NIPEV   FK+   +M+ +Q+KLD+++ PI + LYGAV+R+P ELL  YE  GL QIS+GRVGVLLMAGGQGTRLG + PKGMYD+GLPSHKSLY+IQ ERIR L RLA +  G    + W IMTSEHTMEPT  +F+++ YFGLD+  +I FEQ +LP FTFDGKII++  +KIS++PDGNGG+++ALRDRK+LDEI++ G+QYLHAHSVDNILVKVADP+FIGYC+ K A+C AKVV+K+ P+E LGVVC VDGK+QVVEYSEIT  TAE RN+DG LTF AGNICNHFFT DFL  +A K+  +LKLHVAKKKIPYV+ +G +C PE+ NGIKMEKF+FDVF F + L VWEV R++EFSALKNAD   GKD P TAR D++SLH +F+ ++GG F   E I CEISPL+SYAGE L+ +V G++F S L LKS +E
Sbjct:    1 MSDISEIKSLLLKHDQAHILRFWDRLSDNEREELCQDVRETNIPEVCSYFKRASDSMTDSQEKLDDRLKPIPSHLYGAVSRTPAELLATYEHEGLLQISEGRVGVLLMAGGQGTRLGSSNPKGMYDVGLPSHKSLYQIQAERIRRLTRLAKEKTGKEGRITWIIMTSEHTMEPTLNFFQKHKYFGLDKNDVILFEQGLLPCFTFDGKIILDKQHKISRAPDGNGGLYRALRDRKILDEIENRGIQYLHAHSVDNILVKVADPVFIGYCVKKGADCAAKVVQKSSPTEALGVVCNVDGKYQVVEYSEITLKTAEMRNNDGSLTFRAGNICNHFFTADFLKKIANKHERELKLHVAKKKIPYVDCDGNLCIPEKPNGIKMEKFVFDVFPFSSNLVVWEVNREDEFSALKNAD-SAGKDCPSTARNDIYSLHERFIREAGGDFSCNETIVCEISPLVSYAGEGLEKVVGGQVFKSPLHLKSDDE 480          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|1233176458|ref|XP_022189563.1| (UDP-N-acetylhexosamine pyrophosphorylase-like [Nilaparvata lugens] >gi|1233209664|ref|XP_022204097.1| UDP-N-acetylhexosamine pyrophosphorylase-like [Nilaparvata lugens] >gi|1152526132|gb|AQW43008.1| UDP-N-acetylglucosamine pyrophosphorylase [Nilaparvata lugens])

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 305/481 (63.41%), Postives = 381/481 (79.21%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKF-ITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEE 481
            MSD + I +LL K+DQ HI+ FW+RL++ E+E L  D+RE NIPEV   FK+   +M+ +Q+KLD+++ PI + LYGAV+R+  ELL  YEQ GL QIS+GRVGVLLMAGGQGTRLG + PKGMYD+GLPSHKSLY+IQ ERIR L RLA    G    + W IMTSEHTMEPT  +F+++ YFGLD+  +I FEQ +LP FTFDGKII++  +KIS++PDGNGG+++ALRDRK++DEI++ G+QYLHAHSVDNILVKVADP+FIGYC+ K A+C AKVV+K+ P+E LGVVC VDGKFQVVEYSEIT  TAE RN+DG LTF AGNICNHFFT DFL  +A K+  +LKLHVAKKKIPYV+ +G +C PE+ NGIKMEKF+FDVF F + L VWEV R++EFSALKNAD   GKD P TAR D++SLH +F+ ++GG F   E+I CEISPL SYAGE L+ +V G+++ S L LKS +E
Sbjct:    1 MSDINEIKSLLLKHDQAHILRFWDRLSDHEREELCQDVRETNIPEVCSYFKRASDSMTDSQEKLDDRLKPIPSHLYGAVSRTSPELLDLYEQEGLVQISEGRVGVLLMAGGQGTRLGSSNPKGMYDVGLPSHKSLYQIQAERIRRLTRLAKDTTGKEGRITWIIMTSEHTMEPTLNFFQKHKYFGLDKNDVILFEQGLLPCFTFDGKIILDKQHKISRAPDGNGGLYRALRDRKIMDEIENRGIQYLHAHSVDNILVKVADPVFIGYCVKKGADCAAKVVQKSSPTEALGVVCNVDGKFQVVEYSEITLKTAEMRNNDGSLTFKAGNICNHFFTADFLKKIANKHEKELKLHVAKKKIPYVDSDGNLCIPEKPNGIKMEKFVFDVFPFSSNLVVWEVNREDEFSALKNAD-SAGKDCPSTARNDIYSLHERFIREAGGDFSCNESIVCEISPLASYAGEGLEKVVGGQVYKSPLHLKSEDE 480          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|939690507|ref|XP_014289230.1| (PREDICTED: UDP-N-acetylhexosamine pyrophosphorylase [Halyomorpha halys])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 294/480 (61.25%), Postives = 378/480 (78.75%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEE 481
            M+D   I   L+++ QEH++ FW++L++ +++ L+ DI+E+NIPEVV  FK+    ++ +Q+KLD+++ PI +  YG+ +R+P +LL  YE++GL++I++GRVGVLL AGGQGTRLG   PKGMYD+GLPSHKSLY+IQ ERIR L  +A K FG    + WFIMTSEHTM PT ++F +NNYFGLD+  +IFFEQ +LP FTFDGKII++  +KIS +PDGNGGI++ALRD+++L+ I S G++YLH+HSVDNILVKVADP+FIGYC+ K A+C  KVVEKA+P+EPLGVVC VDGK+QVVEYSEIT  TAE RN+DGRLTFSAGNICNHFFT DFL  +A K+  +LKLHVAKKKI Y++  G  C+PE+ NGIK+EKFIFDVF F   L VWEV R++EFSALKN D  N KDNP TAR DV+SLHR+F+E +GGKF    + CEISPL+SYAGE L+ +V GK+F S L L    E
Sbjct:    1 MTDIAEIKLFLEEHGQEHLLQFWDKLSKDDRDELIQDIKEINIPEVVSYFKRSSEILNDDQEKLDDRLKPIPSSCYGSYSRTPADLLASYEELGLKEIAEGRVGVLLQAGGQGTRLGSFDPKGMYDVGLPSHKSLYQIQAERIRKLCEIAEKRFGNPCIITWFIMTSEHTMAPTEEFFVKNNYFGLDKNNVIFFEQGLLPCFTFDGKIILDKPHKISLAPDGNGGIYRALRDKQILNIIDSRGIKYLHSHSVDNILVKVADPVFIGYCVKKGADCAGKVVEKAFPAEPLGVVCSVDGKYQVVEYSEITHKTAEMRNNDGRLTFSAGNICNHFFTADFLRKIAEKHEHELKLHVAKKKIKYIDSEGKRCEPEKPNGIKIEKFIFDVFPFSKNLVVWEVNREDEFSALKNGDSAN-KDNPTTARKDVYSLHRRFIEAAGGKFEDGTVICEISPLVSYAGEGLEPIVSGKVFTSPLYLSGPNE 479          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|939241343|ref|XP_014239928.1| (PREDICTED: UDP-N-acetylhexosamine pyrophosphorylase-like protein 1 [Cimex lectularius])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 289/481 (60.08%), Postives = 374/481 (77.75%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITEN-IECEISPLLSYAGENLKHLVDGKIFNSALELKSAEE 481
            MSD +     L  Y QEH++ FW+ L++ +++    +I+++++PEV+G FKK +     ++ K+D+++ PI   LYGAV+R+PK LL  YE+ GL QI++GRVGVLLMAGGQGTRLG   PKGMYD+GLPSHKSLY+IQ ERIR L  +A + +G    + WF+MTSEHT+ PT ++F +N YFGLD+  II FEQ +LP FTFDGK I++  NKIS++PDGNGGI++ALRDRK+L+ I++ G++YLHAHSVDNILVKVADP+FIGYC+ K AECGAKVVEKAYP+E LGV+C VDGK+QVVEYSEIT  TAEKRN+DG+LTFSAGN+CNHFFT +FL  VA  +   LK+HVA+KKIPYV+  G   KPE+ NGIK+EKF+FDVF+F + L VWEV+R+EEFSA+KN +    KD P TAR DVF+LHRK VE++GG+F T+  +  EISPLLSYAGE L+ +V GK F+S L L +  E
Sbjct:    1 MSDIEDYRRHLANYGQEHVLQFWDDLSQDDRDEFFQEIKDIDVPEVLGYFKKAVEGRDESKAKIDDRLMPIPPGLYGAVSRTPKALLQSYEEEGLLQIAEGRVGVLLMAGGQGTRLGSTDPKGMYDVGLPSHKSLYQIQAERIRKLASMAEEKYGKKCVITWFVMTSEHTLAPTIEFFTKNRYFGLDKNNIIIFEQGLLPCFTFDGKFILDKPNKISQAPDGNGGIYRALRDRKILNIIENRGIKYLHAHSVDNILVKVADPVFIGYCVKKGAECGAKVVEKAYPTEALGVLCSVDGKYQVVEYSEITLETAEKRNNDGKLTFSAGNVCNHFFTAEFLRKVADNFEKALKIHVAEKKIPYVDAEGKRRKPEKNNGIKLEKFVFDVFQFSDNLVVWEVDREEEFSAVKNGE-GAAKDTPITARKDVFALHRKLVERAGGRFDTQGPVVVEISPLLSYAGEELERIVKGKTFSSPLHLTAPNE 480          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|510953436|gb|AGN56418.1| (UDP N-acetylglucosamine pyrophosphorylases 1 [Locusta migratoria])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 284/475 (59.79%), Postives = 372/475 (78.32%), Query Frame = 0
Query:   12 LKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITE---NIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEEIS 483
            L KY Q+H++ FW+ L+E+E+  LL D++E+N+ EV   F++ + +++ +Q KLD++M PI AE YG V RS  E L  YE+ GL QIS G+VGVLL+AGGQGTRLGV+YPKGMYD+GLPSHKSLY++Q ERI  L  LA +  G    + W+IMTSE TM PT++YF  +NYFGL ++ I+ FEQ +LP FTFDGKIIM+   K+S++PDGNGG+++ALRDRKVLD+I+   ++YLHA+SVDNILVKVADP+FIGYCI+KNAECGAKVVEK++P EP+GVVC+VDG++QVVEYSEIT  TAE+ + DGRLTF AGNICNHFFTT+FL  +A K+ + LKLHVA+KKIPYV+  G +CKPE+ NGIKMEKF+FDVF+F +    WEV+R+EEFSALKNAD    KD P TAR D++SLH +++ ++GGK + +   ++ CEISPLL+YAGE L+ +V+ K F S + L    E S
Sbjct:   11 LTKYGQQHLLRFWDELSEEERAELLLDLQEVNVAEVTSYFRRAVESLTEDQAKLDDRMKPIPAEFYGGVIRSEAEDLRFYEEEGLRQISAGKVGVLLLAGGQGTRLGVSYPKGMYDVGLPSHKSLYQVQAERILRLQELACERTGVYNHITWYIMTSEATMCPTQEYFANHNYFGLKKENIVMFEQGLLPCFTFDGKIIMDRKYKLSRAPDGNGGLYRALRDRKVLDDIERRDIKYLHAYSVDNILVKVADPVFIGYCISKNAECGAKVVEKSFPEEPVGVVCQVDGRYQVVEYSEITLKTAEQSDIDGRLTFRAGNICNHFFTTEFLQKIANKHENNLKLHVARKKIPYVDAQGNLCKPEKPNGIKMEKFVFDVFQFADNFVTWEVKRNEEFSALKNADSAE-KDTPTTARNDLYSLHYQYLTRAGGKIVADKGSSVICEISPLLTYAGEGLEEIVNNKTFKSPVTLLHPSEQS 484          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|1227994494|ref|XP_021929033.1| (UDP-N-acetylhexosamine pyrophosphorylase [Zootermopsis nevadensis] >gi|646708284|gb|KDR14652.1| UDP-N-acetylhexosamine pyrophosphorylase [Zootermopsis nevadensis])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 283/483 (58.59%), Postives = 371/483 (76.81%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITEN---IECEISPLLSYAGENLKHLVDGKIFNSALELKSAEE 481
            MS+ + I   L K++Q H++ FW+ L E++K  L  DI+E+N+ EV   F+K + T++ +Q KLD++M P+  ELYG V RS  + L  YE  GL+QIS+G VGVLLMAGGQGTRLGV YPKGMYD+GLPSHK L+++Q ERIR L  LA    G    + W+IMTSE TM+ T ++FKE+N+FGL++  I+ FEQ +LP FTFDG+IIM+   KI+++PDGNGGI++ALRD+ +LD++++ G+++LHAH+VDNILVKVADP+F+GYC+ KNAECGAKVV+KA P E +GV+C+VDG++QVVEYSEIT  TAEK NSDG+LTFSAGNICNHFFTT+FL  +A K  S L+LHVAKKKIPYV+ NG   KPE  NGIKMEKF+FDVF + +R  +WEV+R+EEFS LKNAD    K++P T R D+FSLHR +++ +GG F+  N   + CEISPL+SYAGE L  LV  K F S + L+SA+E
Sbjct:    1 MSELEKISITLGKFNQSHVLQFWDELTEEQKTILCCDIKEVNVAEVCSYFQKAMETLNEDQSKLDDRMEPVPPELYGGVVRSSPDELKSYEAEGLQQISEGNVGVLLMAGGQGTRLGVLYPKGMYDVGLPSHKPLFQLQAERIRKLEDLAYDRTGKRSSITWYIMTSEATMDATEEFFKEHNFFGLNKNNIVMFEQGLLPCFTFDGRIIMDEKWKIARAPDGNGGIYRALRDKNILDDMENRGIKFLHAHAVDNILVKVADPVFVGYCVKKNAECGAKVVDKASPQEAVGVICKVDGQYQVVEYSEITSKTAEKCNSDGKLTFSAGNICNHFFTTEFLRKIADKVESNLQLHVAKKKIPYVDVNGQRHKPERPNGIKMEKFVFDVFPYADRFVIWEVKREEEFSPLKNADTAE-KESPTTCRKDIFSLHRSYIQDAGG-FVETNGMAVICEISPLVSYAGEGLDKLVSKKKFKSPVLLRSAQE 481          
BLAST of XM_015507631.1 vs. GenBank_protein
Match: gi|1101352115|ref|XP_018902053.1| (PREDICTED: UDP-N-acetylhexosamine pyrophosphorylase [Bemisia tabaci])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 291/481 (60.50%), Postives = 366/481 (76.09%), Query Frame = 0
Query:    2 MSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGMFKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQISQGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRLANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYMLPAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHAHSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKFQVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKLKLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVERDEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFI-TENIECEISPLLSYAGENLKHLVDGKIFNSALELKSAEE 481
            M D   + +LL  ++Q HI+ FW+ L++ EKE LL DI+  N+PE    F+  + T+   + KLD+ M PI + LYGAV+R+  E L  YE IGLE IS G+VGVLL+AGGQGTRLGV YPKGMYD+GLPSHKSLY+IQ ERIR L  LA +  G    + WFIMTSEHT EPT ++FK++N+FGL++  +I FEQ MLP FT DGKII+++ +KISK+PDGNGGI++AL+D  +L  +++ G++YLHAHSVDNILVKVADPIFIGYCI K A+CGAKVVEK+ P+E LGV+C V+GKFQVVEYSEIT  TA K++ DG+LTF AG+ICNHFFTTDFL NVA K+ S LKLH+AKKKIP+V+ NG  C P++ NGIKMEKFIFD F+F + L VWEV RDEEFSALKNAD   GKD PKTA   ++ LH+KF+E++GG F    +  CEISPL+SYAGE LK+++  K   S + LK   E
Sbjct:    1 MIDVVEVRSLLAAHNQSHILQFWDNLSDIEKEELLKDIKSTNVPEATSYFQSSIATLEETK-KLDDLMQPIPSHLYGAVSRTSSEDLELYENIGLESISNGQVGVLLLAGGQGTRLGVTYPKGMYDVGLPSHKSLYQIQAERIRKLCELAEERTGKYGTITWFIMTSEHTKEPTLEFFKKHNFFGLNKNDVILFEQGMLPCFTLDGKIILDNRSKISKAPDGNGGIYRALQDNGLLRVMETRGIKYLHAHSVDNILVKVADPIFIGYCIHKKADCGAKVVEKSSPTEALGVICSVNGKFQVVEYSEITLETAMKQDDDGKLTFRAGSICNHFFTTDFLRNVATKFESDLKLHIAKKKIPFVSSNGQRCIPDKPNGIKMEKFIFDAFQFSDHLVVWEVSRDEEFSALKNAD-SAGKDCPKTAIKALYRLHKKFLEEAGGIFDGNSDCICEISPLISYAGEGLKNIIKEKPLKSPVLLKKPNE 479          
The following BLAST results are available for this feature:
BLAST of XM_015507631.1 vs. GenBank_protein
Analysis Date: 2018-05-22 (Blastp: NCBI Gnomon 20160302 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|985391722|ref|XP_015363117.1|0.000e+0100.00PREDICTED: UDP-N-acetylhexosamine pyrophosphorylas... [more]
gi|1229879611|ref|XP_022183731.1|0.000e+092.34UDP-N-acetylhexosamine pyrophosphorylase [Myzus pe... [more]
gi|193632108|ref|XP_001944680.1|0.000e+091.29PREDICTED: UDP-N-acetylhexosamine pyrophosphorylas... [more]
gi|1148974633|gb|AQS60688.1|0.000e+063.62UDP-N-acetylglucosamine pyrophosphorylase [Sogatel... [more]
gi|1233176458|ref|XP_022189563.1|0.000e+063.41UDP-N-acetylhexosamine pyrophosphorylase-like [Nil... [more]
gi|939690507|ref|XP_014289230.1|0.000e+061.25PREDICTED: UDP-N-acetylhexosamine pyrophosphorylas... [more]
gi|939241343|ref|XP_014239928.1|0.000e+060.08PREDICTED: UDP-N-acetylhexosamine pyrophosphorylas... [more]
gi|510953436|gb|AGN56418.1|0.000e+059.79UDP N-acetylglucosamine pyrophosphorylases 1 [Locu... [more]
gi|1227994494|ref|XP_021929033.1|0.000e+058.59UDP-N-acetylhexosamine pyrophosphorylase [Zootermo... [more]
gi|1101352115|ref|XP_018902053.1|0.000e+060.50PREDICTED: UDP-N-acetylhexosamine pyrophosphorylas... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008152 metabolic process
molecular_function GO:0070569 uridylyltransferase activity
InterPro
Analysis Name: InterProScan on NCBI Gnomon 20160302
Date Performed: 2018-05-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029044Nucleotide-diphospho-sugar transferasesGENE3D3.90.550.10coord: 1..438
e-value: 4.8E-179
score: 597.5
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILY53448Nucleotide-diphospho-sugar transferasescoord: 5..477
NoneNo IPR availableGENE3D3.40.1630.20coord: 439..484
e-value: 2.5E-8
score: 35.5
NoneNo IPR availablePANTHERPTHR11952:SF4UDP-N-ACETYLHEXOSAMINE PYROPHOSPHORYLASEcoord: 8..445
NoneNo IPR availablePANTHERPTHR11952:SF4UDP-N-ACETYLHEXOSAMINE PYROPHOSPHORYLASEcoord: 446..476
NoneNo IPR availablePANTHERPTHR11952UDP- GLUCOSE PYROPHOSPHORYLASEcoord: 8..445
coord: 446..476
NoneNo IPR availableCDDcd04193UDPGlcNAc_PPasecoord: 90..411
e-value: 0.0
score: 529.1
IPR002618UDPGP familyPFAMPF01704UDPGPcoord: 60..411
e-value: 9.5E-57
score: 192.4

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000065contigJOTR01000065:710841..712298 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on NCBI Gnomon 201603022018-05-22
Blastp: NCBI Gnomon 20160302 vs NR2018-05-22
Blast2GO on NCBI Gnomon (20160302)2018-05-22
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
XM_015507631.1rna3672Diuraphis noxiamRNAJOTR01000065 710623..712689 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>rna3672 ID=rna3672|Name=XM_015507631.1|organism=Diuraphis noxia|type=polypeptide|length=486bp
MMSDFDSIIALLKKYDQEHIITFWNRLNEKEKEFLLDDIRELNIPEVVGM
FKKXLGTMSANQQKLDNKMNPISAELYGAVNRSPKELLIKYEQIGLEQIS
QGRVGVLLMAGGQGTRLGVNYPKGMYDIGLPSHKSLYRIQGERIRCLIRL
ANKDFGCCKGLPWFIMTSEHTMEPTRKYFKENNYFGLDEKKIIFFEQYML
PAFTFDGKIIMESMNKISKSPDGNGGIFKALRDRKVLDEIKSLGVQYLHA
HSVDNILVKVADPIFIGYCITKNAECGAKVVEKAYPSEPLGVVCEVDGKF
QVVEYSEITENTAEKRNSDGRLTFSAGNICNHFFTTDFLNNVAYKYNSKL
KLHVAKKKIPYVNGNGIVCKPEELNGIKMEKFIFDVFEFCNRLAVWEVER
DEEFSALKNADIPNGKDNPKTARLDVFSLHRKFVEKSGGKFITENIECEI
SPLLSYAGENLKHLVDGKIFNSALELKSAEEISNK.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0070569uridylyltransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
IPR002618UDPGP_fam