HiSeq10088 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10088
Unique NameHiSeq10088
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1155
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10088HiSeq10088_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10088 ID=HiSeq10088|Name=HiSeq10088|organism=Ostrinia scapulalis|type=mRNA|length=1155bp
TTTAGTTTTATTTTTAAGTAATAGCCTAGGAGTGTCTGGATTAGCGAAGC
AAACTTTGATATGGCGATTTCGCTCTTTGGTATATTTCCCAATCCGAATA
ATTTGCTTCGGTTTTGGACAGTTGTCGATGACACTGTTGAGAATCTTCAA
CACCTCCTGTTGATCATTTTGGCGTCTTTGGTTGCCATCTGTGTCGTAAG
GCTCTGGTATGCCAGAAATGATGATATTATTCATTCTGTTGTTACGGTCC
TGAATTTCCATAACTATTTCCTCGTTCAGAATATTTGAAGATTCAGATGT
CGGCTTTTTTTGTAGTAAGTCAGATTCCAATGTTTGTAGTTTTTCTTGTG
TAGTTGTTAGTTTATCAGAAACTTGAACAAAACCGGTCTCAATATTTTGC
ATTTTCACTTCACTGGCGCTTACTTGATTATTTAGTCTTGATAATTCAGA
TTTGATATTATTTTGCTCAGTGACAAGAGCTGAAGTCGAGTGTTTTATTT
CTAGCATCTGGTCTTTTATATCATTAATGTTTTGTTTTATACTTTCCGTT
GTTACATCCTGTTTGCCACTGATTTTTTCGAGTAGTTCTGTCATGCGACC
AAGTTCCTTACGCAATCCAGCTATCTCCTCTTTACAGTCACACTCTTTCT
CAGGTTGTTTTCTTTTCCTTTGAGTAATGTTTTCGAGTTCAACATTAGAC
AGATTTGTTAGGGATCCCGTTCTTGTAGGAAGTGACCTTGTTGGGGAGTG
TTGGACATTCATTTTTTCGTTTCGGTGAAATTTACTTACGAACTTTTGTC
TGTCGTGCGTTGATATGATGACTGTGCGTGGTTCGTATTCGCCTTTTCGT
TCCGTTTCGGCGCAGTGTGGGCAGTTACCGGATTCGTATAAAAGACAGAG
TCGAAAAATTGCAGCGGATCGTTCTCGCGGGGGTGCCTCGCGGGTGTGAT
GACTTCGCCGCAAGCAGTGCCACAATAACAAATGTCTTAAGCGAAGTTAC
ACTGTCCAATTCACTTAACACGTTATTAAGTTGAGTCAAGGCACATTTCA
CTAAAAACTGTTATTAAAATTTTTGTAACTAACGATGTACGCGTCTGCTT
CGTTTGACCACTGGACGGCTTTTCGTTTTCGCATTTCGACGTTTCATCTC
CCAAA
back to top

protein sequence of HiSeq10088

>HiSeq10088_p ID=HiSeq10088_p|Name=HiSeq10088|organism=Ostrinia scapulalis|type=polypeptide|length=267bp
LGDETSKCENEKPSSGQTKQTRTSLVTKILITVFSEMXXLTQLNNVLSEL
DSVTSLKTFVIVALLAAKSSHPRGTPARTIRCNFSTLSFIXESGNCPHCA
ETERKGEYEPRTVIISTHDRQKFVSKFHRNEKMNVQHSPTRSLPTRTGSL
TNLSNVELENITQRKRKQPEKECDCKEEIAGLRKELGRMTELLEKISGKQ
DVTTESIKQNINDIKDQMLEIKHSTSALVTEQNNIKSELSRLNNQVSASE
VKMQNIETGFVQVSDKX
back to top