HiSeq101 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq101
Unique NameHiSeq101
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length604
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq101HiSeq101_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq101 ID=HiSeq101|Name=HiSeq101|organism=Ostrinia scapulalis|type=mRNA|length=604bp
TTATTGACAAATATATTTATCCTAAGTTGACCAAGTCGTCGCGATTCTCG
AAGTTAACGGTGAGGTGTACGCAGCCGATGTCCTCGCCTCCGTCCATTAT
GTACAGATCGACACCAAACTGGCCGTACATGCCTTGCTCGGGCAGCTCCG
CGTAATTGAACACGTAGTTTGATATCGAGTGGTTGCCCGCAGGTATAGGA
CATAAGGGTGGGCTCATGCCCATGGAATTGATCAAGCAATCCTCTACGTT
TTCTTTGGCGTATTTCTCAGCGAAATTACAGTAGCAGTCGTCTTCCAATA
CTGCAGTGGGCTTGCAGCCGCCATCCACGTGTTTGCATATATCAACGCGG
ACCCCGAAAGTTTCATCTAGGTCCCTGTCCAAATATATATAGCCGCTGAA
GCCATCATGGGTCCGGTTGACCTTCCTCCGGTTAAAAACAAACTGGAACG
GGGATTTTTCGTTGTCGACACAACGCTCCACGTGGATAACCATCCAGCTG
CCCGGGCCCACCAAGACTGACGGTAGTACACAAATACAGCAAGGTATCAA
AATTGCGAAAACCCAATACTTTAACATGATAGAATCAAGTGGCAGAGGGC
GCGG
back to top

protein sequence of HiSeq101

>HiSeq101_p ID=HiSeq101_p|Name=HiSeq101|organism=Ostrinia scapulalis|type=polypeptide|length=158bp
MVIHVERCVDNEKSPFQFVFNRRKVNRTHDGFSGYIYLDRDLDETFGVRV
DICKHVDGGCKPTAVLEDDCYCNFAEKYAKENVEDCLINSMGMSPPLCPI
PAGNHSISNYVFNYAELPEQGMYGQFGVDLYIMDGGEDIGCVHLTVNFEN
RDDLVNLG
back to top