HiSeq10103 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10103
Unique NameHiSeq10103
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length513
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10103HiSeq10103_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10103 ID=HiSeq10103|Name=HiSeq10103|organism=Ostrinia scapulalis|type=mRNA|length=513bp
TGCATGGGGGGCCTGGGCGGCAGCCTTTCTCATCTGAGTCAGCACGTTGC
TTAGTTCTTCACGCTTCCTCTTGGCGCGGATGTGTGTGCCCAGGCGACGC
TTCAGGAATTTCAGTGCACGCTTATCCTTTGACACCTTCAGCAACTCCAT
AGCTCTCTTCTCATACTGTGCATGACCAACAACCTCACGGACTAGATCTC
GCACGAATTTTGAATGCTTTGTTTGCAGACCCTTCAATCTAGCTGGTCTT
ATTTTGATGGTTTTGTCTTCCCTGCCTTTCTTGCCGGCAGATATTTTAGT
TGTTTTGTGGCCTTTTCGCAGACCGACTGCGATCTCAAACCGGGGAGCCA
TGCTGAAAAACAAATACGGTCACGGTAAGATACAAAATACGTATGCCAAA
CTTCTATTCCAGTATTTAGAGCACTAAACTGCACATAAATGAAAAGGAAT
AATCACAGATTCTATAGATATTTTAAAATATTTTCTTCAAAATTATTTAC
GTACTTTACGGAT
back to top

protein sequence of HiSeq10103

>HiSeq10103_p ID=HiSeq10103_p|Name=HiSeq10103|organism=Ostrinia scapulalis|type=polypeptide|length=117bp
MAPRFEIAVGLRKGHKTTKISAGKKGREDKTIKIRPARLKGLQTKHSKFV
RDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREEL
SNVLTQMRKAAAQAPHA
back to top