HiSeq10104 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10104
Unique NameHiSeq10104
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length822
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10104HiSeq10104_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10104 ID=HiSeq10104|Name=HiSeq10104|organism=Ostrinia scapulalis|type=mRNA|length=822bp
GGCGAGCGCGCCCGCGCAGGCTCCGCTGAGCGCGTGGGCCACCGGGTCGT
ACGCGCGCGCCGGGTTCAGCGCCGCCTGGCACCACTCGTACGTCACGAAG
TGCAGCGCCTGGAAGGGCACGTTCATGGCGACCTGCGTGGCGTAGGAGCG
GTAGAAGGCGCGCAGGCCCTCGGCGCGGTACACGTGGCGCGCGCACTCCC
ACACGCCGCGGTACGGCGAGTTCAGCATCTGCAGCCGCTGCTTCACCACT
TCAGCGGGGTTGGAGACGGCGTCGTGCACGAGCGAGGCCAGGCAGCCGGA
CAAACCATGTGTGAGATGTTCGTGGCGATGCCTGGTGAGGTGCGCGAGCG
TCTGCTTGCTGTGCTCGTAGGTGGCGAAGAAGCACGCGTGCGCCGGGCCC
GCGCCCACCACCACCGCCGACATGCCGCGGATGGGCCTGAGCAGACCCTC
CCGCTTGACCATGTACCGAAATGTCTCCGTGATGGTGCTGTTGTGTGCTG
TCCGTAGCGACTGCATCCGCGTCTTGACGGAGTCGAGGGGATACATTATG
CAATGCTCCATCACCCCCGCAATTGCTCCGGCAGTCATGTGTGTGGTGAA
GTTTTGACTGGTCGGAAGGGTTTCATAGTCCTCAAAGTTCATAATACTCA
CTGAATACTGACACTTAGCACAAAATAAACACTGATTATATTAAATTATA
GGAGTTTCGCCTTTTTTACCGAATTAGCAATATCATTTTCACTAAACACT
ATTTTCGTCACAATTCGAAATTTAGAACAATCAAAATTGATTCCAGCGCG
ACTACAAGCACGCGCGACAAAT
back to top

protein sequence of HiSeq10104

>HiSeq10104_p ID=HiSeq10104_p|Name=HiSeq10104|organism=Ostrinia scapulalis|type=polypeptide|length=275bp
FVARACSRAGINFDCSKFRIVTKIVFSENDIANSVKKAKLXXNXXYNQCL
FCAKCQYSVSIMNFEDYETLPTSQNFTTHMTAGAIAGVMEHCIMYPLDSV
KTRMQSLRTAHNSTITETFRYMVKREGLLRPIRGMSAVVVGAGPAHACFF
ATYEHSKQTLAHLTRHRHEHLTHGLSGCLASLVHDAVSNPAEVVKQRLQM
LNSPYRGVWECARHVYRAEGLRAFYRSYATQVAMNVPFQALHFVTYEWCQ
AALNPARAYDPVAHALSGACAGALA
back to top