HiSeq10105 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10105
Unique NameHiSeq10105
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length516
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10105HiSeq10105_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10105 ID=HiSeq10105|Name=HiSeq10105|organism=Ostrinia scapulalis|type=mRNA|length=516bp
AGAAGTGTGCGGGCGTCCGTCGACGCGTCGATGGCTATGTACAGGAATTT
ATTCGACGTTCAAGATCGACCCCTCGCGCCGGGCTTAGGTGCGCGTGAGC
GGCGCAGGATGTCGCGGGTCGGGCGCGGCGGCGGCCAGTCGCAGCGCGGC
GCAGGCCAGCGGCGGCGCGGTACTACTGGCACTACTGGCGGCCGCGGTAC
TACCGGCCGCGGCACTACCGGCGGGCGGCGGCTCGATCTGCGGGCAGGAC
GCGCGTTAGGGCGACTCGGCCACCACGGCGCACGGCCGGCCCACGTCCTT
GGCGAGCGCGTGCTTGATGGTCTCGTAGGTGAGCCAGCAGATGGCGGCGG
CGGGCATCTGGTACAGCACGCGCGCCTGCACGCCCTTGAAGAAGCCCAGC
GGGCCCGTCGCGCGCAGCACCGCCGACGCCGCCTCCAGCAGCCCGTCCGC
GCGCGCCGCCGCCTCCTGCGTGTTGAGCACGGTCTTGCAGACGTCGAGCG
GCGTGGTGGAGGCGGC
back to top

protein sequence of HiSeq10105

>HiSeq10105_p ID=HiSeq10105_p|Name=HiSeq10105|organism=Ostrinia scapulalis|type=polypeptide|length=86bp
AASTTPLDVCKTVLNTQEAAARADGLLEAASAVLRATGPLGFFKGVQARV
LYQMPAAAICWLTYETIKHALAKDVGRPCAVVAESP
back to top