HiSeq10106 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10106
Unique NameHiSeq10106
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1529
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10106HiSeq10106_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10106 ID=HiSeq10106|Name=HiSeq10106|organism=Ostrinia scapulalis|type=mRNA|length=1529bp
ACAAAGCATTTTATTCTTCAGTAACGTGCTTTAACAAAATTATTTTCCAC
ATACATTCCGTTTATTTTGTAAAAACATTACTATTAAATAACTATGTGAA
ATGTTTTTAAATCAATGCGTCCTTAATTTGCAATAAAATGTATTTATTTA
ATGTACAATTTTATTTATCATTCAAAACGGTTTTCGAAAACAATTTCATT
ATTTTATGCTACTTATTAATTGGAAACGTTAATTTGAAAGCGAAATAATT
ATTAATTATTGTACCAGATATAATTTAACTTTCCAAATGAATAAATAAAT
ATTTAAACTCGAGCCGTTCATTGGAACAATTGAATGTGTAGCATTAAACA
TGAAACAATGGGAAATGCTTATTAAAATATAAACGTACTACTAAATTATT
TTCATCCGCTGAACGAATAACAAAAACTGCAGTTTTATTTATATTTAAAC
TTCAAGGTAATATGGTCTAAATTTTATAGATACGTATGTACTTATATTTA
ATCCATCATCTTTCTTATTTAAGCCTAACACAATATCTTAGAAAACTTAC
ATTTTGTACAATATTTATTTCATTGCCTTTTTTTATAAAATTCGTTCCAA
ATAGTTTATAAATAACAAAGATTTAATTTAGCATAGATTCAAATTCAATA
ACAGAACAAAATACCTCGAAACAAAAACGATTATAAAATGTAATTTCTAC
AAATAATTATTTAACATGAAAAATTTTCGTTGGAGCATGTTATCAATTAA
CACATTTTACACCGATTAATTTACACAAACTCATTTAAAGCATTGATACG
AAACTGCAAACGAATTTGTTCCTGATACCGTCCAAATATTGTCTCTCCCG
TAAACCAATTACACTTATTTACATTTTACAAAAATATATTTACACGCGGC
GAAGATATTTACATTCCGGTAACGGCCCATTTTATTTAATATACGGCACG
TTCGGCAGGATTTCGGGTCTTCGGCGATGATGCGACCCGTGATGCCTTAA
ATGTATGACAGCTTCTCTCATTTTCTGCTCCCTCAGCGCTCGTATGTAAT
CTTCATCCACCGTATGCCTATTTTTCTCGGCACGCAACAAAGACTTATCC
GCCCTCTCACTGTCTTTAAACAAAACACACCACAGAGACTTGTCCTTGTT
ATCCCAAAGCAAAGACTTGGTGTACTCTTTCAATCTCCGACTGTTCTCCT
CGACGCGGCGCATAGCTATTTCTATCTTCACCAAATCCTTGTAGTGGTCC
GATACGGGCTGGGATGTCGTGTTAACCTCACTAGTTCTGGCACTTATATT
AATTCGCGACAAGTAATAATTTTCATATTGTCCCGCGGAGTTTCTAGTCC
GCAGCAACCACACAACACTGGCTATGAAAGTGCAGGAAATGATGAATGTT
AGAGTGAGTAAAGTCAGTCTGAAGATGACATTTAGTGATGCACAGCTCAT
ATCACTACTTGTTTGTTTTGCGCTACGAGGTTAGGCATGCCGCGGCGTAG
CGTGGCTACGAGCGCTACGCGTCCGCCTG
back to top

protein sequence of HiSeq10106

>HiSeq10106_p ID=HiSeq10106_p|Name=HiSeq10106|organism=Ostrinia scapulalis|type=polypeptide|length=93bp
MRRVEENSRRLKEYTKSLLWDNKDKSLWCVLFKDSERADKSLLRAEKNRH
TVDEDYIRALREQKMREAVIHLRHHGSHHRRRPEILPNVPYIK
back to top