HiSeq10203 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10203
Unique NameHiSeq10203
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length813
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10203HiSeq10203_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10203 ID=HiSeq10203|Name=HiSeq10203|organism=Ostrinia scapulalis|type=mRNA|length=813bp
GCTTCTTGTGTCAAAGAAAGTAGGTGATTTTGTTTTGAAAAAATCCATGT
TAATCGTATGAAAATAGTAAAATATTGATGGTTTAGTTACTACAAAGTGC
GATTAATATTGTTTCACTACAGTGTTAATTTATATTTCTGTAAATAATCC
TTCCTAAGTTTATTTCCAAGTTGTCAAACTTAAAGGTTAGCTATCAATCA
ACAGAACCTTACTATTTTGTATTTTTAGGCCTCACCATGAAGCAAATCGT
TGCTAACCAAAAGGTGAAGATCCCTGATGGGCTCACAGTTCACGTTAAGT
CGCGGCTGGTGACAGTGAAAGGCCCGCGCGGTGTGTTGAAAAGGAACTTC
AAGCACTTGGCTGTGGACATTCGCATGGTGAATCCACGGCTCCTCAAAGT
AGAGAAATGGTTCGGCTCAAAGAAAGAGCTCGCTGCTGTCAGGACAGTCT
GCTCACACGTTGAAAACATGATCAAAGGTGTGACCAAGGGTTTCCAGTAC
AAGATGCGTGCAGTATACGCTCACTTCCCCATCAACTGTGTAACCACTGA
AGGCAACTCAATCATTGAAATCCGTAACTTCCTTGGTGAGAAATACATCA
GAAGGGTAAAGATGGCACCTGGTGTGACCGTCGTCAACTCACCCAAACAA
AAAGATGAGCTGATCATCGAAGGAAACTCATTGGAAGATGTCTCCAGCTC
TGCAGCTCTCATCCAACAGTCAACCACCGTCAAGAACAAGGATATCCGAA
AATTCTTAGACGGTCTTTATGTTTCTGAAAAAACAACTGTTGTTATGGAT
GAAATATAAGGAA
back to top

protein sequence of HiSeq10203

>HiSeq10203_p ID=HiSeq10203_p|Name=HiSeq10203|organism=Ostrinia scapulalis|type=polypeptide|length=190bp
MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP
RLLKVEKWFGSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPIN
CVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLE
DVSSSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVMDEI
back to top