HiSeq10204 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10204
Unique NameHiSeq10204
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length724
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10204HiSeq10204_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10204 ID=HiSeq10204|Name=HiSeq10204|organism=Ostrinia scapulalis|type=mRNA|length=724bp
GCTTCTTGTGTCAAAGAAAGTAGGTGATTTTGTTTTGAAAAAATCCATGT
TAATCGTATGAAAATAGTAAAATATTGATGAATTAGTTACTACACAGTGC
GATTGATATTGTTTCACTACAGTGTTAATTTATATTTCTGCCTCACCATG
AAGCAAATCGTTGCTAACCAAAAGGTGAAGATCCCTGATGGGCTCACAGT
TCACGTTAAGTCGCGGCTGGTGACAGTGAAAGGCCCGCGCGGTGTGTTGA
AAAGGAACTTCAAGCACTTGGCTGTGGACATTCGCATGGTGAATCCACGG
CTCCTCAAAGTAGAGAAATGGTTCGGCTCAAAGAAAGAGCTCGCTGCTGT
CAGGACAGTCTGCTCACACGTTGAAAACATGATCAAAGGTGTGACCAAGG
GTTTCCAGTACAAGATGCGTGCAGTATACGCTCACTTCCCCATCAACTGT
GTAACCACTGAAGGCAACTCAATCATTGAAATCCGTAACTTCCTTGGTGA
GAAATACATCAGAAGGGTAAAGATGGCACCTGGTGTGACCGTCGTCAACT
CACCCAAACAAAAAGATGAGCTGATCATCGAAGGAAACTCATTGGAAGAT
GTCTCCAGCTCTGCAGCTCTCATCCAACAGTCAACCACCGTCAAGAACAA
GGATATCCGAAAATTCTTAGACGGTCTTTATGTTTCTGAAAAAACAACTG
TTGTTATGGATGAAATATAAGGAA
back to top

protein sequence of HiSeq10204

>HiSeq10204_p ID=HiSeq10204_p|Name=HiSeq10204|organism=Ostrinia scapulalis|type=polypeptide|length=190bp
MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP
RLLKVEKWFGSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPIN
CVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLE
DVSSSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVMDEI
back to top