HiSeq10212 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10212
Unique NameHiSeq10212
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length527
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10212HiSeq10212_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10212 ID=HiSeq10212|Name=HiSeq10212|organism=Ostrinia scapulalis|type=mRNA|length=527bp
AAAATGAGAGCCATAACCTTCGTGATCCTGTGCTGTGCTCTGCAGTATGT
TGCTGCAGATGCTATCATAGACAGCATTACGGGCTGGGAAAAACAATTCA
CTGAAACAAATGAAACTTCAACAGACGAATTCGAAACCGACCGCAGTGGA
CATGTCGTTGAAAAATCAACTGTTCGAAAGACTTTCCACAGGGATTCCGC
TCCACCAAACAAAAATATTCATGGTCAAGACAAGATAGTACGGACCTTTG
TCATCGAAACCGATGCATTCGGTCACGAAACTATCTACGAAGAAGATGTT
GTCATCAAGCAGGTGCCAGGATCTTCGTCATCTTCTAGTTCATCTGCTAG
TTCTGCCGCTGGTGGATCAGGCAAGTATGGACCAAATGCAGCAGGATCCT
CAACTGCAGCGTCTGCATTAGCGGCAAACGGGCCATACGGACCACGAGGA
CAAGGATCAGCAGCTGCTGCTGGCGCTGCTGCTTCAGGACCAAATGGACC
ATACAGACCATACGGACCAAACGGCCC
back to top

protein sequence of HiSeq10212

>HiSeq10212_p ID=HiSeq10212_p|Name=HiSeq10212|organism=Ostrinia scapulalis|type=polypeptide|length=112bp
KMRAITFVILCCALQYVAADAIIDSITGWEKQFTETNETSTDEFETDRSG
HVVEKSTVRKTFHRDSAPPNKNIHGQDKIVRTFVIETDAFGHETIYEEDV
VIKQVPXIFVIF
back to top