HiSeq10215 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10215
Unique NameHiSeq10215
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2433
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10215HiSeq10215_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10215 ID=HiSeq10215|Name=HiSeq10215|organism=Ostrinia scapulalis|type=mRNA|length=2433bp
ATCTACTGAATTTTATTCGGGGGATGCTGAAAACCGTTACATATTTATTG
CCAATACCAATACAGTTTGGTTTGGTGTTGCAATGTGAGAAAAATAAAAT
AAATAATGATGAGGATAATGTATTGATAGATGGCGTTAATCATCAGTGAA
GAATAGTGCCGACTACTTACGAAGTTTCTTCTTACGCTTTTCTAATGTAC
TTATTACAGCAGAAGGAAGCTGAAAACTAGATTCATATCAATAATAGATT
GAGGCTTTTAATTGGTTTAATTTCAAGATATCACCAATCTTAAGGCAGAA
TCTACGACTGATATAGAATCGAGTTCTGAACCTTGTTTCGTAATACGGAC
CTTAGTACCTATGTAATAATGTAGAGTTTAGGTAAGCGTGAGCATTTGTG
AATGCTGAGTGATGTGCATGTGTCCTTGCCGCGCGGCGGGCTCGGTGCGC
GCGCGCATCTTGCAGCGAAGCAGCTGCAGAGTGTTCTCCCACAGCTTGGT
TTGCTCCTCCACCACGCCCTGGCGGGAACTTATCGCTCGTTGTTCCTCTT
CCAAATTCTTTACTATCTGTTCCATGTCAGCCACTTTTTTCTTCAGCGCT
TCAATCCTGGATGGTTTCCTCGGCGATTGCATTGAATTTTTCATTTCAAG
CATTACAACTTCTTGCAGACTCTCCGCTTTTGTTATTTTTTGCCGTAAGT
TTTTCCATTCGTCCTCTTTACTGTTCAATTGGTCGGTCAACTCTTTTACT
TTGTTTTTAAGTGGTTCCATTTGCGAAGTTATGTTTATCGACGTCGCTTC
GTATACTCGTTTCTTCTGTTCATATTGTTGTTGTACACTTTGAAATTCTT
CTTTTATGGGCTTTATTTTGTCTGCCAACGGTTGAATCTCCTGACGGACC
TGTGACAGCTTTTGGGCAGTTTGCGCTACCAGCTGCGACAAGTCATGCAA
TGATTTCTTGGCCAAATCATCCGTTTTATTTTGGTCCTTTTCCATCGCTT
CATCATCGTCAATTTTTAACTTTTTGTGATTCACCAGTGCCATTTCGACA
GTTGGATCGGCTGCGCTAATTATGTTTAGGGTTCTCGTTAAAATCCCCGT
CTCAACCTTGAACGTGGAAAGATTGGCTCGTTGCCTTTTGTACACTGTGC
TCTTGGTGCGCAGTGAATTGACGTATTTCTTCAATTCTTCCCCACGTAGT
ACCGTATCGCCGAGTAACTGCCTCACCTGCGACTGCAGATCTGCCAGTGT
AGCCTCATACTCCTTCAAGCTCGCAGCCAGCTCGTGCACCCGCGCAGCAC
TCGCGTCCTTATTGCGTCGGATCACGGCTGCTTGTTGCCTGAACGGCGCC
AGCTTGTCTTCCTGAGGGCCGCTGGAAGCCAGGCGGCGCTGCACCAGCTG
CTCCAATTCACCGTTAACTACTGCTATCTTGTCTTGCACTAACACTAAGT
CGGACCGAGTGAGATGTTGCTCCGTGGCAATGTTCTGCATAATGCTCAGT
TCTTTCTGAAGGTTGCCAGTTTCCTGTGGCAATTTTTCCTTTACAAGGTA
ACTATTTAACTGAACCTCCTCTTTCAAATGCTTAATGACGTCATTAACTG
TCTTCGGAGCCGCGCTCTGTCCGTGGATTACGTTCAGATATCTTTTTAGC
TGATCTGATGCGATTTTTAACTGTGATTGCTGGGTTTCATACTGATTTTC
CAGTTCCTTTGTTTTTTCCTGCTGCATTCTTAAACTTCTGCTTGTGTTGA
GTAGTTCGTCCTTATTGCTTATATCGACTAAGTTCACTTGCACGTTTTCT
AATCTCTTAATAACAATATCTCTCTCGACCGCCATTTCTTTTATGTCATT
AATAATTTCAGACGAGTTTTCCTTTTGTAGTAACCTCGTTCTTTTGTGGA
CCTCCTTGAACTCATCCATAAGGTTATGATACAAATCCAACATGTCCTGG
ATAGTATTATTCTGCGCCACATCAGTAGGGATGTCAGGAATCTTCAGATA
CTTGGCGAGGTAAGCAGTATTCTTCACTTGTTCCTTGTTTGTCAGCAGCC
AGTGCAGCACATGGTGGATAGTTCTGGCATCACCAGCCAAAAGTTGCGCC
CTGAAACGCGGCGGCTCTACGCTCGCTGGTGGCCGATACTTCACGCTGCC
CAGCATTTCCAAAAGCCGCACCGAGACCGTCTCGGAATCGTCTTCATTTA
TGTCCAACTTTTCTCCTGCATTGAAATTAACCAGCAAGTCCACTAAAAGT
TGCAGGAGTTGTTTCTCGTTCAAAGAGTCGAACTTGATCAAGTCGTAGTT
CCTGCCCAAGTTAGAATTCAATTCCTTTACTATGAACTTTATTTGCTCTG
TCATATTGCTTTGCTAGTTTGTAACAAAATGCTACGAACTAAACACAACG
CTATTTTTAATAAATTCACTTTGTCGATTTGAT
back to top

protein sequence of HiSeq10215

>HiSeq10215_p ID=HiSeq10215_p|Name=HiSeq10215|organism=Ostrinia scapulalis|type=polypeptide|length=658bp
MTEQIKFIVKELNSNLGRNYDLIKFDSLNEKQLLQLLVDLLVNFNAGEKL
DINEDDSETVSVRLLEMLGSVKYRPPASVEPPRFRAQLLAGDARTIHHVL
HWLLTNKEQVKNTAYLAKYLKIPDIPTDVAQNNTIQDMLDLYHNLMDEFK
EVHKRTRLLQKENSSEIINDIKEMAVERDIVIKRLENVQVNLVDISNKDE
LLNTSRSLRMQQEKTKELENQYETQQSQLKIASDQLKRYLNVIHGQSAAP
KTVNDVIKHLKEEVQLNSYLVKEKLPQETGNLQKELSIMQNIATEQHLTR
SDLVLVQDKIAVVNGELEQLVQRRLASSGPQEDKLAPFRQQAAVIRRNKD
ASAARVHELAASLKEYEATLADLQSQVRQLLGDTVLRGEELKKYVNSLRT
KSTVYKRQRANLSTFKVETGILTRTLNIISAADPTVEMALVNHKKLKIDD
DEAMEKDQNKTDDLAKKSLHDLSQLVAQTAQKLSQVRQEIQPLADKIKPI
KEEFQSVQQQYEQKKRVYEATSINITSQMEPLKNKVKELTDQLNSKEDEW
KNLRQKITKAESLQEVVMLEMKNSMQSPRKPSRIEALKKKVADMEQIVKN
LEEEQRAISSRQGVVEEQTKLWENTLQLLRCKMRARTEPAARQGHMHITQ
HSQMLTLT
back to top