HiSeq10219 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10219
Unique NameHiSeq10219
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1316
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10219HiSeq10219_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10219 ID=HiSeq10219|Name=HiSeq10219|organism=Ostrinia scapulalis|type=mRNA|length=1316bp
GAACGAAGTTTTCGAAAATGTTAACTCTCAATTAATTAATGAAAAGGCTG
AATCAACTGAAATAGTAGAAAAGTTTATCGGAACAAATCTTAATTATAAA
CATAAGATTAATTGGTCTATTACTAGACGTCTGGTGATAATTCATATCTT
GGCATTATGGGGTCTTTTAAAGATTTTGAAAGGAGAAGTTTATTCAGCGA
CTATTTATTGGACTTTTTCTATCGCACATCTCAGTTACATTGGAAGCTCT
ATTGGTGTTCATAGATATTACTCCCATAGATCGTTCAAAGCTACGCCACT
TCTTGAAATTATATTAATAGTGTTACAGACCATTTCGGGACAAGATACGG
TCTTCAGATGGGCTACGGACCACAGGCTCCATCATCGGTATGCGGACACC
GACGCCGATCCTCACAATGTGAAACGTGGATTTTTCTTCTGCTACTTCGG
ATGGTTGTGCGTTAAGAGGAACAAATATGTGATGGAACTTGGGAGAAAAG
TCAATACGAGCGACCTTATGGCAAATAAGTTCGTGATGTTTCAAAAAAGA
TACTATTTACCCTTATTATTGTTAGTCAATGCCAGTATAGCCTGGGTCCC
GGTACGTTATTTCGACGAGTCGTGGTGGAACTCTGTGCTGGTGGCTTCCT
TCTTCCGATACGCGTTTCAAATACATTTCACGGGGCTAGTGGTTGCTTTA
AGCCACTCTATTGGAACAAGACCTTATAATAAAAATCTCCAGGCAATAGA
CTCGTGGCCATTGACCATTCTGTCTTGGGGTGACGGAGGCCATAACTTCC
ATCACGTCTTTCCGTGGGATTACAAAAGTGCAGAGGGACACAACATAATT
TCCCTTGTTATTTGGACTTTTGAAAAGCTCGGATTGGCCTCAGACTTGAA
AACGGTCCCAAAAGAAACGGTAAAAAATATAATCAAAATGGTTGGAGACG
GAACACATCCCAGCTTTGGGACTGAAGAGGGCAAGTCTCTCGTCACAGCG
GTAGGTCCAGTGCACCCCTTGAATCCCACCTACAGAAACATTAAGGACCC
TGAAATAATCGTACGAGTGGTTGGATCGAAGACTGTATTCGGCGAAGACC
TCGTAAGAGAAGAGAGAAGTGTTGGCTGACTCTATTTAATTCGCTATAAT
AATGTTTTAGGTACGAGTATATGCCTATATTTCCTATTGTGCATGGTTTA
GATTAAGTTGTGGATGCCTATACTAAAACGTTTATTCTATTTGTATAGAT
AACAATAGTAGACGGACAAACCTCTAGCTAGAGGTTTTAAGACACTATTT
AATAAAAAATGTAACG
back to top

protein sequence of HiSeq10219

>HiSeq10219_p ID=HiSeq10219_p|Name=HiSeq10219|organism=Ostrinia scapulalis|type=polypeptide|length=375bp
NEVFENVNSQLINEKAESTEIVEKFIGTNLNYKHKINWSITRRLVIIHIL
ALWGLLKILKGEVYSATIYWTFSIAHLSYIGSSIGVHRYYSHRSFKATPL
LEIILIVLQTISGQDTVFRWATDHRLHHRYADTDADPHNVKRGFFFCYFG
WLCVKRNKYVMELGRKVNTSDLMANKFVMFQKRYYLPLLLLVNASIAWVP
VRYFDESWWNSVLVASFFRYAFQIHFTGLVVALSHSIGTRPYNKNLQAID
SWPLTILSWGDGGHNFHHVFPWDYKSAEGHNIISLVIWTFEKLGLASDLK
TVPKETVKNIIKMVGDGTHPSFGTEEGKSLVTAVGPVHPLNPTYRNIKDP
EIIVRVVGSKTVFGEDLVREERSVG
back to top