HiSeq20503 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq20503
Unique NameHiSeq20503
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1020
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq20503HiSeq20503_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq20503 ID=HiSeq20503|Name=HiSeq20503|organism=Ostrinia scapulalis|type=mRNA|length=1020bp
TGAAATCTGATTGGTTATTCAAAATACTTCTCCGCTCCACTCTGCTTTGG
TGGAAACAGGGCCATAGTCGTCAAGTCGTTTCCCGAATGAATCTTGTCAG
AAGAAAGAGGTATGAGTGACATTAGTAAATTCTTTTTCCTCAATTTCAGT
CTGAAAAACCTGAATATGACTTCGGTTCGGCGGCACGCATCGTAGTAGCA
GGGAGCACCGTCTATCCAACTGCATTGTATTATTGGTACAGATTTTTGGA
CAAGACGTTCGCGGGAACTGCAGTGAAAACAGTGGCTAAGAAGGTGGCTG
CTGAACAGTTTATTGCCACTCCAATATTGCTGGCAGCTTTTTACACGCTA
ATCGGTGTTCTCGAAAGAAAGGAAGACGTGTTCGAAGAATTGCGGGAAAA
GTATACAAAGACATTGATAGCAAACCAGGCGTTCTGGATTCCCTCCCAGA
CTGTGAACTTCTTTTTTGTGCCTCCTCATTTGAGGGTGGTGTACGTTGCT
ACAGTGTCTTTCGTGTGGATAAATGTTCTGTGCTTCATCAAAAGACAGAA
GAATGGTAAAGTTGCTGAGAAATAGGAGTTATGACGTTAATAAGGAATCA
AGTTATTTAAAGGTGTACAAAAGTGCTAATATAGCTCGTTTAAGTAACAA
GGACTTGTAGTTTATGGTAATAAACTGATTGTATTTGCAAGATATGTAAA
TAAATGTGTAAATAATTGAATATTTTATGTATCATGAATATAAATAAATG
CATGTATGTACCTTTAACAGATGTGATAATCTAAATTAACATTGACACTG
GTAGGTAGCATACAAAAATGTAGAAATTAATTTAGGAAATGATGTATGAT
TTATAATTTTGTTAATTAAATGCTAGCAATAAGATTAGTAGTTACTTAAG
TAAAATAAGTACAAAATGGATTAATCATGTTGTTACAACGTCACCTGTGC
AAGTTCCTCTTGTGTTAATAGCAACTAATTGATGTAACATATCAGCGATC
GGTACGAATAAATAAAAATA
back to top

protein sequence of HiSeq20503

>HiSeq20503_p ID=HiSeq20503_p|Name=HiSeq20503|organism=Ostrinia scapulalis|type=polypeptide|length=136bp
MXFGSAARIVVAGSTVYPTALYYWYRFLDKTFAGTAVKTVAKKVAAEQFI
ATPILLAAFYTLIGVLERKEDVFEELREKYTKTLIANQAFWIPSQTVNFF
FVPPHLRVVYVATVSFVWINVLCFIKRQKNGKVAEK
back to top