OSCA000936-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA000936-RA
Unique NameOSCA000936-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length5169
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1990contignewscf_1990:25210..41561 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.38
QI0|0|0|1|0.33|0.44|34|0|1722
AED0.29
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA000936OSCA000936Ostrinia scapulalisgenenewscf_1990 25210..41561 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA000936-RAOSCA000936-PAOstrinia scapulalispolypeptidenewscf_1990 25210..41561 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA000936-RA:cdsOSCA000936-RA:cdsOstrinia scapulalisCDSnewscf_1990 25210..25503 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA000936-RA:exon:831OSCA000936-RA:exon:831Ostrinia scapulalisexonnewscf_1990 25210..25503 -
OSCA000936-RA:exon:832OSCA000936-RA:exon:832Ostrinia scapulalisexonnewscf_1990 26951..26987 -
OSCA000936-RA:exon:833OSCA000936-RA:exon:833Ostrinia scapulalisexonnewscf_1990 27031..27163 -
OSCA000936-RA:exon:834OSCA000936-RA:exon:834Ostrinia scapulalisexonnewscf_1990 27197..27297 -
OSCA000936-RA:exon:835OSCA000936-RA:exon:835Ostrinia scapulalisexonnewscf_1990 27374..27483 -
OSCA000936-RA:exon:836OSCA000936-RA:exon:836Ostrinia scapulalisexonnewscf_1990 27529..27695 -
OSCA000936-RA:exon:837OSCA000936-RA:exon:837Ostrinia scapulalisexonnewscf_1990 28459..28666 -
OSCA000936-RA:exon:838OSCA000936-RA:exon:838Ostrinia scapulalisexonnewscf_1990 29422..29571 -
OSCA000936-RA:exon:839OSCA000936-RA:exon:839Ostrinia scapulalisexonnewscf_1990 29628..29771 -
OSCA000936-RA:exon:840OSCA000936-RA:exon:840Ostrinia scapulalisexonnewscf_1990 29780..30046 -
OSCA000936-RA:exon:841OSCA000936-RA:exon:841Ostrinia scapulalisexonnewscf_1990 30376..30561 -
OSCA000936-RA:exon:842OSCA000936-RA:exon:842Ostrinia scapulalisexonnewscf_1990 30669..30770 -
OSCA000936-RA:exon:843OSCA000936-RA:exon:843Ostrinia scapulalisexonnewscf_1990 31744..31912 -
OSCA000936-RA:exon:844OSCA000936-RA:exon:844Ostrinia scapulalisexonnewscf_1990 32384..32620 -
OSCA000936-RA:exon:845OSCA000936-RA:exon:845Ostrinia scapulalisexonnewscf_1990 33033..33204 -
OSCA000936-RA:exon:846OSCA000936-RA:exon:846Ostrinia scapulalisexonnewscf_1990 33860..33985 -
OSCA000936-RA:exon:847OSCA000936-RA:exon:847Ostrinia scapulalisexonnewscf_1990 34057..34222 -
OSCA000936-RA:exon:848OSCA000936-RA:exon:848Ostrinia scapulalisexonnewscf_1990 34284..34379 -
OSCA000936-RA:exon:849OSCA000936-RA:exon:849Ostrinia scapulalisexonnewscf_1990 34386..34445 -
OSCA000936-RA:exon:850OSCA000936-RA:exon:850Ostrinia scapulalisexonnewscf_1990 34505..34681 -
OSCA000936-RA:exon:851OSCA000936-RA:exon:851Ostrinia scapulalisexonnewscf_1990 34844..34996 -
OSCA000936-RA:exon:852OSCA000936-RA:exon:852Ostrinia scapulalisexonnewscf_1990 35142..35302 -
OSCA000936-RA:exon:853OSCA000936-RA:exon:853Ostrinia scapulalisexonnewscf_1990 36054..36201 -
OSCA000936-RA:exon:854OSCA000936-RA:exon:854Ostrinia scapulalisexonnewscf_1990 36795..36956 -
OSCA000936-RA:exon:855OSCA000936-RA:exon:855Ostrinia scapulalisexonnewscf_1990 37062..37153 -
OSCA000936-RA:exon:856OSCA000936-RA:exon:856Ostrinia scapulalisexonnewscf_1990 37278..37465 -
OSCA000936-RA:exon:857OSCA000936-RA:exon:857Ostrinia scapulalisexonnewscf_1990 37508..37737 -
OSCA000936-RA:exon:858OSCA000936-RA:exon:858Ostrinia scapulalisexonnewscf_1990 38683..38734 -
OSCA000936-RA:exon:859OSCA000936-RA:exon:859Ostrinia scapulalisexonnewscf_1990 38740..38911 -
OSCA000936-RA:exon:860OSCA000936-RA:exon:860Ostrinia scapulalisexonnewscf_1990 39258..39405 -
OSCA000936-RA:exon:861OSCA000936-RA:exon:861Ostrinia scapulalisexonnewscf_1990 39921..40052 -
OSCA000936-RA:exon:862OSCA000936-RA:exon:862Ostrinia scapulalisexonnewscf_1990 40392..40568 -
OSCA000936-RA:exon:863OSCA000936-RA:exon:863Ostrinia scapulalisexonnewscf_1990 40933..41071 -
OSCA000936-RA:exon:864OSCA000936-RA:exon:864Ostrinia scapulalisexonnewscf_1990 41449..41561 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA000936-RA ID=OSCA000936-RA|Name=OSCA000936-RA|organism=Ostrinia scapulalis|type=mRNA|length=5169bp
ATGCACGTTGCCGTAGGCATGACAGGTTGGGCCGTGTACCAGCAAAGAGG
CGGCAAGGAGGGGCACTTCAGAACCACGCAGTACTTGTATTACGTCATCG
CCGCTTGGGAAATGCAACAAGGTCCGGGCGGCGGGTCAGCCGACAACCGG
TTCGTATTCAAACGGCGGCTGTTCCGCGGCGGACGCGAGTTACCTCACGA
CCCAGTCGAAGTCGCCCTGCTCTATGCACAAGCCGTTCACAGCGTCGTCA
AGCTGGACGAGTTCCCAGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGG
CTACAGGCGCAGGTGTCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCC
ACACACGCGCGCCTACTACTCTCATCCCGACCAGTTCTTACCTCAGCGCA
TCGCTAGGGCGCGCCCGGCGCACCAGTGGTATACGAGAAGGTGGCATTAC
AACTGGCAGGGCTGCAGGCACAGGTGTCTCTTGGAGAACCTCCACCGAGC
CCGCCGCCGCCGCACACGTGCGCCTACTACTCGCATCCCGACTAGTTCTT
ACAGAGGGCAAGCTACAATCCTCGCCCAAGCGCACCGGCAGTACGGCGCC
GGGCGCGCGGAGCTGACGGCCAAGGCTTTATACCTGTCCTGCGTTATGCA
GTACCCGCTGTATGGCGTCACGCTGTTCCCCGTCACTTACAAGGGATATT
GGGCGCATGGTCCAAACGTACTCCTAGGAGTAGGCTCGGAAGGCGTGGTC
CTGGTCAGGCCGGCAGACAAGGTGGTGCTTGCAGAGTATCCTTACAGCAA
CATTGCGGCGCTGCTCATGGATCCCGTGGATAATGGGCTCACCATTAGTC
TCACGCACCATGGACAGCATGACGGGCATAGATTACGTGCTTACTTCTTA
CGCGAAAACTTGTGGTTGCACGGAGTGGATGATCTAGACAAGTTCCCAGT
ATCCGAGAAGGTGGCGCTACAACTAGCAGGGCTGCAAGCGCAGGTGTCAT
TAGGGGAGCCGCCGCCGAGCCCGCCGCCGCCACACACGCGCGCCTACTAC
TCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCGCGCCCGGC
GCATCAGTGGGTGAGTGTTATTGCGAGGGAAAAGGGTTCATTTTCGCCTG
GGGAAGGGACGGAGAGGGGTGTCTCTCTGCAACTAGACGAGCTCCCAGTA
TCAGAGAAGGTGGCATTACAACTGGCAGGGCTGCAAGCGCAGGTGTCGCT
AGGAGAGCCGTCGCCGCACACGCGCGCCTACTACTCGCATCCCGACCAGT
TCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACATCAATGGGTGAGT
TTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAGGCACAGGTGTC
GCTAGGAGAGCCACACGCGCGCCTTCTACTCGCATCCCGACCACTGGACA
AGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAAGCG
CAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACTACTCGCA
TCCCGACCAGTTCTTACCTCAACGCATTGCTAGGGCGCGCCCGGCGCATC
AATGGGCTACAATCCTCGCACAAGCGCACCGGCAGTACGGCGCCGGGCGC
GCGGAGCTGACGGCCAAGGCTTTATACCTGTCGTGCGTCATGCAGTACCC
GCTGTATGGCGTCACGCTGTTCCCCGTCACGTACAAGGGCTATTGGGCGC
ATGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCTGCAGGCGCAGGTG
TCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCGGCACACGCGCGCCTA
CTACTCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCACGCC
CGGCGCACCAGTGGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTA
GGGCTGCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGC
TTACTACTCGCATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGGCGC
GCCCGGCGCACCAGTGGCTGGATGAGTTCCCAGTATCCAAGAAGGTGGCA
TTACAACTCGCAGGACTACAAGCGCAGGTGTCTCTTGGAGAGCCTCCACC
GAGCCCGCCGCCGCCACACACGCGCGCCTACTACTCGCATCCCGACCAGT
TCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACATCAATGGCTGGAC
AAGTTCCCAGTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAAGC
GCAGCTAGGAGAGCCGTCCCCGCACACGCGCGCCTACTACTCGCATCCCG
ACCAGTTCTTACCTCAACGCATCGCCAGGGCGCGCCCGGCGCACCAGTGG
CTGGACAAGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTAGGGCT
GCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACT
ACACACATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCCCGGCCC
GCACATCAATGGGCGATATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCT
GCAAGCGCAGGTGTCTCGCACACGCGCGCCTACTACTCGCATCCCGACCA
GTTCTTACCTCAGCGCATCGCTAGGGCGCGCCCGGTGCACCAGTCCAAAC
GTACTCCTCGGCGTAGGCTCGGAAGGCGTGGTCCTAGTCAGGCCGGCAGA
CAAGGTGGTGCTAGCTGAGTACCCTTACAGCAACATTGCTGCACTGCTCA
TGGACCCCGTGGATAATGGGCTCACCATTAGTCTCACGCACCATGGACAG
CATGACGGGCATAGATGCATAGTCCTCGAGTCTCCCCAAAAGAACGAGGC
GGCTTGGCTAATGGCAGCCTACAGCCCAGTGCTAGCCAACGGTTTAGCCG
ACGAGCCGCCGCGTCGCGCCGCACCGGCATCGGAACGTTCGCGGCTCGCT
GGAGCCCTAAAGAGCGCCCGCCGAGCGCTGGTTGACTCGGGCATGCTGAG
AAGACCTACGGAACTGTCCGCTGGGAACTTCTTGAGGAATACTTTGAGAA
GACTAAGCAAGCACCGTCTAGAGAAGGTCCGCCTAGACATGGCGGCAGAA
AGTCAGGAAGAGTGCTACAAGAGCTTCCCGGCCGGCTACTGGCGCTGGTC
GCGCTCGCTGCCGCACAGCCTCACCAAGCTCAACGAGGCCGAGGAGGTGG
CCGCCATGCAGATATTCAAGCAGAGAGCCAGGATCTCTTGTCCTGAAGTG
GTCATTAGAATAGGCTATAATTATGAGACGTTGTGGAAATGCTCCAAAAA
GGGTAAACATGGGGAGACGCGGGACATTATGAGCCACGCGGGTCTCAGCA
CGCAAGANGGCAGCACCAGCAACCTGGCCAACAACAACAGCATCAGCAGC
CAGGAGAGCGACAGCGACGACCGCGTGGCGCTGGCGCAGGCGCTGCTGCA
GCGCTGCCTGCAGAAGGACACGCTGCTGTGCGAGCTGTACGTGCAGCTGA
TCAAGCAGTTGGCCTTATCGCGAAAGTTTCGGAAGAGATTTGCTGACACT
ACTTGCATAAATGATAACACATTTGTATTTTGCCAACAGACGACAGACCA
CCCAGAGCCGTCATCGCGCGTGTCCTCCCGCCACTGGGCTTTGCTATGCG
CGGCCATCGGCGCTGCGTTACCGCCTGCCAAACCGCTGCGCCGGCTGCTA
TTAGCTCATCTACGGTACCGAGGCGCGGCGCTGCATACTGGCGAAGACGG
CAAGTTTGCAAGACGTGCAGAACAGATACTAATAAACAGGTTCTCAAGTC
CCAACAAACTAAGTACCACCCAGAAGCGTCATCTCGCGCGTCGAGAAGCC
AATGGCTGTTACGGCAAAGCCGCTGCGCCGGCTGCCGCTAGCTCATCTAC
GGTACCGGGAGGACGGCATAGTTGTCTCTGGGCATTACTGTGCGCGGCTA
TCGGTGTTGCATTACCGCCCGCCAAGCCGCTGCGACGGCTGCTGTTAGCT
CATCTACGGTACCGAGGCGCGGCGCTGCATATGGGCGAAGACGGCAAGTT
CGCACGGCGCGCTGAACAGGTGGCCCTAAGCATAGCCCAAGTGCCCCGCC
GTCTCGCCGCGCCCTCCAAAGAGGAACTGCTATGCGCGGCCGCGAGGAGA
CCTATGCACGTCAGGGTACTACTGCTGGATGGAAAACAGCACGGCCTGGT
GTTTGGACCAGCGGCTACGGCTGACCACCTGGTTACTATGCTGAGAGAAA
AGATCGGCCTTAATGAAGCTGCCACTGGTTACGCGCTATACGAAGTGTGT
GCGGGCACGAGCGCGGGAGCAGGGACGGGCGCGGGCGCAGCGGGCGCGGG
TGAACGCGCACTGGGCGGAAACGAGCGCGTGGGCGACGTGTTAGCGCGAT
GGGAGAAGGCTGGCGCCACCGCTGCGGCTTGCAGGTACAATGTGTTAAAC
TATGCGGTGGCGAGTACGGGTGAACGGGCGCTTGGTGACAGCGAGCGCGT
GGGCGACGTGCTAGCGCGCTGGGAGAAAGCCGGCGCTACGGCTGCGGCCT
GCAGCGCGGGGGCGGGCAGACGCGCCCTGGGCGGGAGTGAGCGCGTGGGC
GACGTGTTAGCGCGCTGGGAGAAGGCTGGCGCCACCGCTGCGGCTTGCAG
GTACATTGAGCTATATGAAGTGTGTGCGGGCACGAGCGCGGGAGCGGCGG
CGGGCGAGCGCGCACTGGGCGGGAACGAGCGCGTTGGCGACGTGCTAGCG
CGCTGGGAAAAAGCCGGCGCTACGGCTGCTGCTTGCAGTTGGCACCCCTG
GCGATTGACAGGACCTTACTCTACAGTTATGCTAGCAGCGCTCCACGCGC
AAGTGGTAAGCGGCGACTGCATGGGCGGCGGCGAGGAGTGTTCCGTAGCC
GCTGGTGCCGTGCTGCCGCCGCGTCTTGCGCCTGCCCTACCCGCGCCCGC
CGTGCGCTTGCATCATTTGGCGCTGCGAGGGACTGACGCCCATGCCGCCA
TGCAGCGAGCGCTGACGCTGGCTGCTTCGTGGCCGCTCGCGAGAGCCACT
ATCTTTGATGTCATGGTGAGTGCCAGCGCCAGCTGTACGACTGCATCATC
TAGCGCTGCGGGGAACTGA
back to top

spliced messenger RNA

>OSCA000936-RA ID=OSCA000936-RA|Name=OSCA000936-RA|organism=Ostrinia scapulalis|type=mRNA|length=5169bp|location=Sequence derived from alignment at newscf_1990:25210..41561- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGCACGTTGCCGTAGGCATGACAGGTTGGGCCGTGTACCAGCAAAGAGG
CGGCAAGGAGGGGCACTTCAGAACCACGCAGTACTTGTATTACGTCATCG
CCGCTTGGGAAATGCAACAAGGTCCGGGCGGCGGGTCAGCCGACAACCGG
TTCGTATTCAAACGGCGGCTGTTCCGCGGCGGACGCGAGTTACCTCACGA
CCCAGTCGAAGTCGCCCTGCTCTATGCACAAGCCGTTCACAGCGTCGTCA
AGCTGGACGAGTTCCCAGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGG
CTACAGGCGCAGGTGTCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCC
ACACACGCGCGCCTACTACTCTCATCCCGACCAGTTCTTACCTCAGCGCA
TCGCTAGGGCGCGCCCGGCGCACCAGTGGTATACGAGAAGGTGGCATTAC
AACTGGCAGGGCTGCAGGCACAGGTGTCTCTTGGAGAACCTCCACCGAGC
CCGCCGCCGCCGCACACGTGCGCCTACTACTCGCATCCCGACTAGTTCTT
ACAGAGGGCAAGCTACAATCCTCGCCCAAGCGCACCGGCAGTACGGCGCC
GGGCGCGCGGAGCTGACGGCCAAGGCTTTATACCTGTCCTGCGTTATGCA
GTACCCGCTGTATGGCGTCACGCTGTTCCCCGTCACTTACAAGGGATATT
GGGCGCATGGTCCAAACGTACTCCTAGGAGTAGGCTCGGAAGGCGTGGTC
CTGGTCAGGCCGGCAGACAAGGTGGTGCTTGCAGAGTATCCTTACAGCAA
CATTGCGGCGCTGCTCATGGATCCCGTGGATAATGGGCTCACCATTAGTC
TCACGCACCATGGACAGCATGACGGGCATAGATTACGTGCTTACTTCTTA
CGCGAAAACTTGTGGTTGCACGGAGTGGATGATCTAGACAAGTTCCCAGT
ATCCGAGAAGGTGGCGCTACAACTAGCAGGGCTGCAAGCGCAGGTGTCAT
TAGGGGAGCCGCCGCCGAGCCCGCCGCCGCCACACACGCGCGCCTACTAC
TCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCGCGCCCGGC
GCATCAGTGGGTGAGTGTTATTGCGAGGGAAAAGGGTTCATTTTCGCCTG
GGGAAGGGACGGAGAGGGGTGTCTCTCTGCAACTAGACGAGCTCCCAGTA
TCAGAGAAGGTGGCATTACAACTGGCAGGGCTGCAAGCGCAGGTGTCGCT
AGGAGAGCCGTCGCCGCACACGCGCGCCTACTACTCGCATCCCGACCAGT
TCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACATCAATGGGTGAGT
TTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAGGCACAGGTGTC
GCTAGGAGAGCCACACGCGCGCCTTCTACTCGCATCCCGACCACTGGACA
AGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAAGCG
CAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACTACTCGCA
TCCCGACCAGTTCTTACCTCAACGCATTGCTAGGGCGCGCCCGGCGCATC
AATGGGCTACAATCCTCGCACAAGCGCACCGGCAGTACGGCGCCGGGCGC
GCGGAGCTGACGGCCAAGGCTTTATACCTGTCGTGCGTCATGCAGTACCC
GCTGTATGGCGTCACGCTGTTCCCCGTCACGTACAAGGGCTATTGGGCGC
ATGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCTGCAGGCGCAGGTG
TCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCGGCACACGCGCGCCTA
CTACTCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCACGCC
CGGCGCACCAGTGGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTA
GGGCTGCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGC
TTACTACTCGCATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGGCGC
GCCCGGCGCACCAGTGGCTGGATGAGTTCCCAGTATCCAAGAAGGTGGCA
TTACAACTCGCAGGACTACAAGCGCAGGTGTCTCTTGGAGAGCCTCCACC
GAGCCCGCCGCCGCCACACACGCGCGCCTACTACTCGCATCCCGACCAGT
TCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACATCAATGGCTGGAC
AAGTTCCCAGTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAAGC
GCAGCTAGGAGAGCCGTCCCCGCACACGCGCGCCTACTACTCGCATCCCG
ACCAGTTCTTACCTCAACGCATCGCCAGGGCGCGCCCGGCGCACCAGTGG
CTGGACAAGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTAGGGCT
GCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACT
ACACACATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCCCGGCCC
GCACATCAATGGGCGATATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCT
GCAAGCGCAGGTGTCTCGCACACGCGCGCCTACTACTCGCATCCCGACCA
GTTCTTACCTCAGCGCATCGCTAGGGCGCGCCCGGTGCACCAGTCCAAAC
GTACTCCTCGGCGTAGGCTCGGAAGGCGTGGTCCTAGTCAGGCCGGCAGA
CAAGGTGGTGCTAGCTGAGTACCCTTACAGCAACATTGCTGCACTGCTCA
TGGACCCCGTGGATAATGGGCTCACCATTAGTCTCACGCACCATGGACAG
CATGACGGGCATAGATGCATAGTCCTCGAGTCTCCCCAAAAGAACGAGGC
GGCTTGGCTAATGGCAGCCTACAGCCCAGTGCTAGCCAACGGTTTAGCCG
ACGAGCCGCCGCGTCGCGCCGCACCGGCATCGGAACGTTCGCGGCTCGCT
GGAGCCCTAAAGAGCGCCCGCCGAGCGCTGGTTGACTCGGGCATGCTGAG
AAGACCTACGGAACTGTCCGCTGGGAACTTCTTGAGGAATACTTTGAGAA
GACTAAGCAAGCACCGTCTAGAGAAGGTCCGCCTAGACATGGCGGCAGAA
AGTCAGGAAGAGTGCTACAAGAGCTTCCCGGCCGGCTACTGGCGCTGGTC
GCGCTCGCTGCCGCACAGCCTCACCAAGCTCAACGAGGCCGAGGAGGTGG
CCGCCATGCAGATATTCAAGCAGAGAGCCAGGATCTCTTGTCCTGAAGTG
GTCATTAGAATAGGCTATAATTATGAGACGTTGTGGAAATGCTCCAAAAA
GGGTAAACATGGGGAGACGCGGGACATTATGAGCCACGCGGGTCTCAGCA
CGCAAGARGGCAGCACCAGCAACCTGGCCAACAACAACAGCATCAGCAGC
CAGGAGAGCGACAGCGACGACCGCGTGGCGCTGGCGCAGGCGCTGCTGCA
GCGCTGCCTGCAGAAGGACACGCTGCTGTGCGAGCTGTACGTGCAGCTGA
TCAAGCAGTTGGCCTTATCGCGAAAGTTTCGGAAGAGATTTGCTGACACT
ACTTGCATAAATGATAACACATTTGTATTTTGCCAACAGACGACAGACCA
CCCAGAGCCGTCATCGCGCGTGTCCTCCCGCCACTGGGCTTTGCTATGCG
CGGCCATCGGCGCTGCGTTACCGCCTGCCAAACCGCTGCGCCGGCTGCTA
TTAGCTCATCTACGGTACCGAGGCGCGGCGCTGCATACTGGCGAAGACGG
CAAGTTTGCAAGACGTGCAGAACAGATACTAATAAACAGGTTCTCAAGTC
CCAACAAACTAAGTACCACCCAGAAGCGTCATCTCGCGCGTCGAGAAGCC
AATGGCTGTTACGGCAAAGCCGCTGCGCCGGCTGCCGCTAGCTCATCTAC
GGTACCGGGAGGACGGCATAGTTGTCTCTGGGCATTACTGTGCGCGGCTA
TCGGTGTTGCATTACCGCCCGCCAAGCCGCTGCGACGGCTGCTGTTAGCT
CATCTACGGTACCGAGGCGCGGCGCTGCATATGGGCGAAGACGGCAAGTT
CGCACGGCGCGCTGAACAGGTGGCCCTAAGCATAGCCCAAGTGCCCCGCC
GTCTCGCCGCGCCCTCCAAAGAGGAACTGCTATGCGCGGCCGCGAGGAGA
CCTATGCACGTCAGGGTACTACTGCTGGATGGAAAACAGCACGGCCTGGT
GTTTGGACCAGCGGCTACGGCTGACCACCTGGTTACTATGCTGAGAGAAA
AGATCGGCCTTAATGAAGCTGCCACTGGTTACGCGCTATACGAAGTGTGT
GCGGGCACGAGCGCGGGAGCAGGGACGGGCGCGGGCGCAGCGGGCGCGGG
TGAACGCGCACTGGGCGGAAACGAGCGCGTGGGCGACGTGTTAGCGCGAT
GGGAGAAGGCTGGCGCCACCGCTGCGGCTTGCAGGTACAATGTGTTAAAC
TATGCGGTGGCGAGTACGGGTGAACGGGCGCTTGGTGACAGCGAGCGCGT
GGGCGACGTGCTAGCGCGCTGGGAGAAAGCCGGCGCTACGGCTGCGGCCT
GCAGCGCGGGGGCGGGCAGACGCGCCCTGGGCGGGAGTGAGCGCGTGGGC
GACGTGTTAGCGCGCTGGGAGAAGGCTGGCGCCACCGCTGCGGCTTGCAG
GTACATTGAGCTATATGAAGTGTGTGCGGGCACGAGCGCGGGAGCGGCGG
CGGGCGAGCGCGCACTGGGCGGGAACGAGCGCGTTGGCGACGTGCTAGCG
CGCTGGGAAAAAGCCGGCGCTACGGCTGCTGCTTGCAGTTGGCACCCCTG
GCGATTGACAGGACCTTACTCTACAGTTATGCTAGCAGCGCTCCACGCGC
AAGTGGTAAGCGGCGACTGCATGGGCGGCGGCGAGGAGTGTTCCGTAGCC
GCTGGTGCCGTGCTGCCGCCGCGTCTTGCGCCTGCCCTACCCGCGCCCGC
CGTGCGCTTGCATCATTTGGCGCTGCGAGGGACTGACGCCCATGCCGCCA
TGCAGCGAGCGCTGACGCTGGCTGCTTCGTGGCCGCTCGCGAGAGCCACT
ATCTTTGATGTCATGGTGAGTGCCAGCGCCAGCTGTACGACTGCATCATC
TAGCGCTGCGGGGAACTGA
back to top

protein sequence of OSCA000936-RA

>OSCA000936-PA ID=OSCA000936-PA|Name=OSCA000936-RA|organism=Ostrinia scapulalis|type=polypeptide|length=1722bp
MHVAVGMTGWAVYQQRGGKEGHFRTTQYLYYVIAAWEMQQGPGGGSADNR
FVFKRRLFRGGRELPHDPVEVALLYAQAVHSVVKLDEFPVSEKVALQLAG
LQAQVSLGEPPPSPPPPHTRAYYSHPDQFLPQRIARARPAHQWYTRRWHY
NWQGCRHRCLLENLHRARRRRTRAPTTRIPTSSYRGQATILAQAHRQYGA
GRAELTAKALYLSCVMQYPLYGVTLFPVTYKGYWAHGPNVLLGVGSEGVV
LVRPADKVVLAEYPYSNIAALLMDPVDNGLTISLTHHGQHDGHRLRAYFL
RENLWLHGVDDLDKFPVSEKVALQLAGLQAQVSLGEPPPSPPPPHTRAYY
SHPDQFLPQRIARARPAHQWVSVIAREKGSFSPGEGTERGVSLQLDELPV
SEKVALQLAGLQAQVSLGEPSPHTRAYYSHPDQFLPQRIARARPAHQWVS
LSEKVALQLAGLQAQVSLGEPHARLLLASRPLDKFPVSEKVALQLAGLQA
QVSLGEPSPHTRAYYSHPDQFLPQRIARARPAHQWATILAQAHRQYGAGR
AELTAKALYLSCVMQYPLYGVTLFPVTYKGYWAHVSEKVALQLAGLQAQV
SLGEPPPSPPPRHTRAYYSHPDQFLPQRIARARPAHQWFPVSEKVALQLV
GLQAQVSLGEPSPHTRAYYSHPDQFLPQRIARARPAHQWLDEFPVSKKVA
LQLAGLQAQVSLGEPPPSPPPPHTRAYYSHPDQFLPQRIARARPAHQWLD
KFPVSEKVALQLAGLQAQLGEPSPHTRAYYSHPDQFLPQRIARARPAHQW
LDKFPVSEKVALQLVGLQAQVSLGEPSPHTRAYYTHPDQFLPQRIARARP
AHQWAISEKVALQLAGLQAQVSRTRAPTTRIPTSSYLSASLGRARCTSPN
VLLGVGSEGVVLVRPADKVVLAEYPYSNIAALLMDPVDNGLTISLTHHGQ
HDGHRCIVLESPQKNEAAWLMAAYSPVLANGLADEPPRRAAPASERSRLA
GALKSARRALVDSGMLRRPTELSAGNFLRNTLRRLSKHRLEKVRLDMAAE
SQEECYKSFPAGYWRWSRSLPHSLTKLNEAEEVAAMQIFKQRARISCPEV
VIRIGYNYETLWKCSKKGKHGETRDIMSHAGLSTQXGSTSNLANNNSISS
QESDSDDRVALAQALLQRCLQKDTLLCELYVQLIKQLALSRKFRKRFADT
TCINDNTFVFCQQTTDHPEPSSRVSSRHWALLCAAIGAALPPAKPLRRLL
LAHLRYRGAALHTGEDGKFARRAEQILINRFSSPNKLSTTQKRHLARREA
NGCYGKAAAPAAASSSTVPGGRHSCLWALLCAAIGVALPPAKPLRRLLLA
HLRYRGAALHMGEDGKFARRAEQVALSIAQVPRRLAAPSKEELLCAAARR
PMHVRVLLLDGKQHGLVFGPAATADHLVTMLREKIGLNEAATGYALYEVC
AGTSAGAGTGAGAAGAGERALGGNERVGDVLARWEKAGATAAACRYNVLN
YAVASTGERALGDSERVGDVLARWEKAGATAAACSAGAGRRALGGSERVG
DVLARWEKAGATAAACRYIELYEVCAGTSAGAAAGERALGGNERVGDVLA
RWEKAGATAAACSWHPWRLTGPYSTVMLAALHAQVVSGDCMGGGEECSVA
AGAVLPPRLAPALPAPAVRLHHLALRGTDAHAAMQRALTLAASWPLARAT
IFDVMVSASASCTTASSSAAGN
back to top

mRNA from alignment at newscf_1990:25210..41561-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA000936-RA ID=OSCA000936-RA|Name=OSCA000936-RA|organism=Ostrinia scapulalis|type=mRNA|length=16352bp|location=Sequence derived from alignment at newscf_1990:25210..41561- (Ostrinia scapulalis)
ATGCACGTTGCCGTAGGCATGACAGGTTGGGCCGTGTACCAGCAAAGAGG CGGCAAGGAGGGGCACTTCAGAACCACGCAGTACTTGTATTACGTCATCG CCGCTTGGGAAATGTGAGTGGGACTTGATCTTCATTTGTTTTGATGCACG TTGCCGTTGGCATAGTAGGTTCTTAGCCGGCTGGGCCGTGTACCAGCAGA GAGGCGGCAAGGAGGAGCACTTCACCAATTTAAAATCGGGCACAACTATC AGTCAACTAAAAATCGGTGGTCTCCGTCTAGTCTAATTGAGTTTATGATC AGTCGAGTTAATACATTGAAGTTCAGCGACATTCCGTTTATTACACAACT AGCTAGTTGACCTGGCGAACTTCATACCTTGTGCTGGCGATAAGACCGGC TGAATTAACTCGAAATCAGTAAATGTTTGAAAATGCAAATTATTTGAACT GAAATATGGCTCTAAAACTACATTTTTGTTTATATCACAGGCAACAAGGT CCGGGCGGCGGGTCAGCCGACAACCGGTTCGTATTCAAACGGCGGCTGTT CCGCGGCGGACGCGAGTTACCTCACGACCCAGTCGAAGTCGCCCTGCTCT ATGCACAAGCCGTTCACAGCGTCGTCAAGGTAAACTATATCCTTCTGACT CTGCCATAGTTCATAGGAGCTTTTGTTGACCCATTAAGACCCTCACTCAA GAGTTGTGATCTTTGAGGAGTATATTAGATCTATGATATCATATCGGCAA CGTAACGTCGGAATAGTCCGAGACGAAAAAGTTTGAAACCTTTGCTGTTC GTGTATATTCGGTACACTTTCAGAAAATCATCACTTCATACACATACTTC AATTATTGATCATAGAGCGCAGCGTGTGCATTTTACTAGGACACGCACAC ATAGATAAGTATCTTAGTTGATGCAATCGGTTGTTTTTAGGTACTAGAAA ACGTGTTCCAATTTCAAAAAGTAAAAAGAACATTTCTTTGCAGCTGGACG AGTTCCCAGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCTACAGGCG CAGGTGTCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCCACACACGCG CGCCTACTACTCTCATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGG CGCGCCCGGCGCACCAGTGGGTGAGTGGTAATCATCATCATTTCAGCCAC AGGACGTCCACTGCTGAACATAGGCCTCCCCCAATGACTTCCACATCGCA CGGTTGGTAGCGGCCTGCATCCAGCGCCCTCCTGCTACCTTTATCAGGTC GTCGGTCCACCTTGTGGGTGGACATCCCACACTGAGTGTGAATGGTATTA TTAAAAGGGAGAGGGGGTTATTCTAGTCCGGGGGAGAGAGTGGGNCGGAG AAGGGAGAGGTTCATTCTGGCCCGGAGGAGAGAAACGGGACATTTTGGCC GGGGTGAGGGGTCATTGTGGATGGAAGGGGCGTCTCTCTGCAGCTGGATG AGTTCCCAGTATACGAGAAGGTGGCATTACAACTGGCAGGGCTGCAGGCA CAGGTGTCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCCGCACACGTG CGCCTACTACTCGCATCCCGACTAGTTCTTACAGAGGGCAAGTTTTGATA CGAGGGTGAGGGGGTCATTCTGGCCCAGGGAAGATAGGGGTCTTTTGCCT ATCTTCCCTGGGCCAAAATGCCCGGAGAAGGGAAGGAACTATTCTGGCCC TGAGGGTGGGAGAAGGTTATTGTGATTGTGGCCCGAAAGAGAGAGTGAGT CATTTTATCCCGTGAGAGGGAAGGTCATTCTGGCCCGGAAGATGCAGGAA TCTATTCTGGCCGGGGAAGGAAGAGGTCATTCCGGCCGTAGAAGGCCTCA TTCGGTCTCAAGAGAAGTTCAGTTTGGCCGGGAAGGGAAGAGTTTATTTT GACCCGTGCCGTGGGTAAAAGAGGGTTATTCTAGTTAAGGAAGGGCTTAT TTTGACCTGAGGGTAAGAAGAGGCCATTGTAGCACTGGAAGGGGTCATTC TACCTCGAGGGATGGAGGGGGTCATTCTGGCTTGGAAGAAGGGTGATTTA AGTCTACAACGTCTTAAATTACGTATTACATATTGTAACTATTCCTTCTC CCGTAGGCTACAATCCTCGCCCAAGCGCACCGGCAGTACGGCGCCGGGCG CGCGGAGCTGACGGCCAAGGCTTTATACCTGTCCTGCGTTATGCAGTACC CGCTGTATGGCGTCACGCTGTTCCCCGTCACTTACAAGGGATATTGGGCG CATGGTAAGTTTTTGTTTTTGCTAGATTAAAATAAGGAAGATAAGGTACG CGATTACATTGCTATTAACCAAACTAGGCCCTGCTACATCACATAGGTCG ATCCAGTGAGCGAGACAGCGAAAACCTCCAAGTGAAAGCGAGATACTAGA TAGCGACTCGGAATCGGAAGAGCGGTATCCGCGCCAAAGCTTATTTGTAC CGCTTCGGCCGTATCTTCCCTTCCAACGTTGAAGCAAAATAGCACATAAT TACCTAAATTTAGCTACAAGATTATATAAAACACCATTATTTTCAGAATG GTCATCTGCACATAAAATCAATTTAATTCTGAAATGTACTTTTCTCCTAG GTCCAAACGTACTCCTAGGAGTAGGCTCGGAAGGCGTGGTCCTGGTCAGG CCGGCAGACAAGGTGGTGCTTGCAGAGTATCCTTACAGCAACATTGCGGC GCTGCTCATGGATCCCGTGGATAATGGGCTCACCATTAGTCTCACGCACC ATGGACAGCATGACGGGCATAGGTAAGATTACGTGCTTACTTCTTACGCG AAAACTTGTGGTTGCACGGAGTGGATGATGTACTATGTGTTTGACCACTG ACATTTTTTTTCTCTTGTTCAGTGTTTCTTTAAGTTGTTTAATTTATGAA CTGCATGTATTTTATTTGTGACTTTGTATGGCATGTTTATTTTATTTTTA AGCTTGTAAGCGCTTTGGACCTGCTCTGTAAGCTTACAAGTGTTTTGCAT TAATTAATAAATAAACTACCGTCTCCCGCCACCCCTATGAAACATACATA CGCTGCTCATACTATTTTCGATAGACAAGTGTTAACGGAGGTCCTTATCC TAATCAACATAGCATCTTAAAGAATGTATTCCTTGCCGAGAATATTCTTT TAACGGTACTGTAGGCGACGCGTGAATGCATTATTTGTTTTTACTTAAAT ACCTAGTTCCTTTGTTAAATACCTAACTATGTATTCTTTATTTGACTTAA TTAAACGTAAGGTGTTGCGCAGGTGACGCGAAGACAGCAGATTCGCGAGG GGCGAGAGGCGCGGGAGGGGCGGGCGCGTGCCCGCTAGTTTTNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNGTGTGAATGGTATTATTAAAAGGGAGAGGGGGTTATTCTAGTCCG GGGGAGAGAGTGGGTACATTCTGCCGCGGAGAAGGGAGAGGTTCATTCTG GCCCGGAGGAGAGAAACGGGACATTTTGGCCGGGGTGAGGGGTCATTGTG GATGGAAGGGGCGTCTCTCTGAAGCTAGACAAGTTCCCAGTATCCGAGAA GGTGGCGCTACAACTAGCAGGGCTGCAAGCGCAGGTGTCATTAGGGGAGC CGCCGCCGAGCCCGCCGCCGCCACACACGCGCGCCTACTACTCGCATCCC GACCAGTTCTTACCTCAACGCATCGCTAGGGCGCGCCCGGCGCATCAGTG GGTGAGTGTTATTGCGAGGGAAAAGGGTTCATTTTCGCCTGGGGAAGGGA CGGAGTTATTCTGACCGGGAGGAGGGACAGGGATCATTCTGGCTAGGAGG GGTGTCTCTCTGCAACTAGACGAGCTCCCAGTATCAGAGAAGGTGGCATT ACAACTGGCAGGGCTGCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGC ACACGCGCGCCTACTACTCGCATCCCGACCAGTTCTTACCTCAGCGCATC GCTAGGGCCCGGCCCGCACATCAATGGGTGAGTTGTTATTGCGAGGGAAA AGGGTTCATTTTAGCCTGGGGGAGGGACGGAGTTATTCTGACCGGGAGGA GGGACAGTGGTCATTCTGGCTAGGAGGGGTGTCTCTCTGCAACTAGACGA GTTCCCAGTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAGGCAC AGGTGTCGCTAGGAGAGCCACACGCGCGCCTTCTACTCGCATCCCGACCA GTTCTTACCTTAACGCATCGCTAGGGCGCGCCCGGCGCACCAGTGGGTGA GTTTTGACGTCTAGGAAAGGGGGTTATTCTGGCCGGGAGGGGTGTCTCTC TACAGCTGGACAAGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGCA GGGCTGCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGC CTACTACTCGCATCCCGACCAGTTCTTACCTCAACGCATTGCTAGGGCGC GCCCGGCGCATCAATGGGTGAGTTTTGATACAAGGGGGAGGGATCATTCT AGGCCGGGGGAGGGACGGAGTTATTCTGCCCGGGAGGAGGGAGAGGGGAC ATTCTGGCCGGGACGGGTGTCTCTCTGTAGCTGGACGAGGTCTTATTATC CAAGAAGGTGGCATTACAACTGGCAGGGCTGCAAGCGCAGGTGTCGCTAG GGGAGCCGCCGCCGAGCCAGGGAAGATAGGGGTCTTTTTGATTTGGAAGA GGAAAGGGGCTATTCTCGCTCAGAGAAGAGAGGGAGCTATTCTGGCCCAG AAGAAGGGAGGGGTTATTCTGGCCTTGAGGATAGATAGTCATTTTTGCCC GTATTTTGGCCGGGCAAGAGGCTTAATCTGGCTAGGAAGGGAAGACGTCA TTTTGACCCGTGGGTAGAAGAGGGTTATTCTAGCTAGGGAAGGGCTCATT TTGACCTGGGGGAGGAAAGAGGTATTTCTGGCACAGGGGAAGGAAGGGGT CATTCTATCTAGGGGGAGGGAGGGAGTCATTCTGTCATGGGGAAGGGACG TGGAGGGGAAGGTAGGAATAACGTACTACATATTGTAACTTTCTATTCCT TCTCCCGTAGGCTACAATCCTCGCACAAGCGCACCGGCAGTACGGCGCCG GGCGCGCGGAGCTGACGGCCAAGGCTTTATACCTGTCGTGCGTCATGCAG TACCCGCTGTATGGCGTCACGCTGTTCCCCGTCACGTACAAGGGCTATTG GGCGCATGGTGAGTCTTTGTTTTTGCTAGATTAAAATAGGGAAGATAAGG TACGCGATTACATTGCTATTAACCAAACTAGGCCCTGCTACATTACATAG GTCGATCCAGTGAGCGAGACAGCGAAAACCTCCAAGTGAAAGCGAGATAC TAGATAGCGACTCGGAAAGTGACGGTGTCAGCTCCGAAGCAAAGTGTGCT TGCACCTAATTTAGGCGGCCCACTTGCGAAATGTTTCGGCCGTATCTTCC CTTCTAAAGTTGAAACAAAATAACATACACCGTGTTACTTTGCATTCTTG CCATATTCACAGAGATAAAAGTAGGTAACAATACCTATTATTTAAGATAA ACAAGAGACTCCCATAAAGAAAGTACACTAAGATTTTAGTAAATTTGGTT TTTCAGTACAAATTGGAATAAACCAATTTTGTCTCGCACGTTCTNATCAT CATTTCAGCCACAGGACGTCCACTGCTGAACATAGGCCTCCCCCAATGAC TTCCACATCGCACGGTTGGTAGCGGCCTACATCCAGCGCCTTCCTGCTAC CTTTATCAGGTCGTCGGTCCACCAAGTGTGAATGGTATTATTAAAAGGGA GAGGGGGTTATTCTAGTCCTGGGGAGGGAGTGGGTACATTCTGGCGCGGA GAAGAAGAGGTTCATTCTGGCCCGGAGGAGAGAAACGGGACATTTTGGCC GGGGTGAGGGGTCATTGTGGATGGAAGGGGTGTCTCTCTCCAGCTAGACG AGTTTCCAGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCTGCAGGCG CAGGTGTCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCGGCACACGCG CGCCTACTACTCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGG CACGCCCGGCGCACCAGTGGGTGAGTGTTGTTGCGAGGGAGAAGGGTTCA TTTTAGCCTGGGGGAGAGACGGAGTTATTCTGGACGGGAGGAGGGAGAGG AGACATTCTGGCTGGGAAGAGTGGTCATTCTGGCCGGGAGGGGTGTCTCT CTGCAACTAGACGAGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGT AGGGCTGCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCG CTTACTACTCGCATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGGCG CGCCCGGCGCACCAGTGGGTGAGTGTAGAAGGAGTTTATTCTGGCATGGT GAAAGGAGAGGTTCATTCTAGAGAGGGGATATTCTGGCGCGGAGAAGGGA GAGATTCATTCTAGATAGGGGATATTCTGGCGCGGAGAAGTGAGAGGTTC ATTCTGGCCGGGAGGGGTGTCTCTCTACAGCTGGATGAGTTCCCAGTATC CAAGAAGGTGGCATTACAACTCGCAGGACTACAAGCGCAGGTGTCTCTTG GAGAGCCTCCACCGAGCCCGCCGCCGCCACACACGCGCGCCTACTACTCG CATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACA TCAATGGGTGAGCTTTGACGTCTAGGAAAGGGGGTTATTCTGGCCGGGAG GGGTGGCTCTCTACAGCTGGACAAGTTCCCAGTATCAGAGAAGGTGGCGC TGCAACTAGCAGGGCTGCAAGCGCAGGTGTAGCTAGGAGAGCCGTCCCCG CACACGCGCGCCTACTACTCGCATCCCGACCAGTTCTTACCTCAACGCAT CGCCAGGGCGCGCCCGGCGCACCAGTGGGTAAGTTTTAACGTCTAGGAAA GAGGGGGTTATTCTGGCCGGGAGGGGTGTCTCTCTACAGCTGGACAAGTT CCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTAGGGCTGCAAGCGCAGG TGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACTACACACATCCC GACCAGTTCTTACCTCAACGCATCGCTAGGGCCCGGCCCGCACATCAATG GGCGAGTTTTGACGTCTAGGAAAGGGGGTTATTCTGGCCGGGAGGGGTGT CTCTCTCCAGCTAAACGAGTTTCCAGTATCAGAAAAAGTGGCGCTGCAAC TAGCAGGGCTGCAAGCGCAGGTGTCTCGCACACGCGCGCCTACTACTCGC ATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGGCGCGCCCGGTGCAC CAGTGGGTGAGTGTGAATCATCATCATTTCAGCCACAGGACGTCCACAGC TGAACATAGGCCTCCCCCAATGACTTCCACATCGCACGGTTGGTAGCGGC CTGCATCCAGCGCCTTTATCAGGTCGTCGGTCCACCTTGTGGCTGCGCGT CCCACACTGAGTGTGAATGGTATTATTAAAAGGGAGAGGGGGTTATTCTA GTCCGGGGGAGGGAGTGGGTACATTCTGGCGCGGAGAAGGGAGAGGTTCA TTCTGGCCCGGAGGAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGACACTTAAGAAAGTTATTG GACAGTTATTTACTGAATTAAAAATAGCATTTCTATTTCAACAACTGAGA GATTCCGACTGATGGAGATAAAAGGGCGTTTTTTTTTTAAGGAATATTCA TTGTATTTGAAGGAATAATCATTTTAAGAAAATTCAAGGGTTGTTTTGTC CAATGACTGGCAGCGTCCAATGACTTCGGTTTACCAAGATTATTACACCA TTATTTTCACATCTCCACATAAAATCAATTTAATTTTGAAATGTACTTTT CTTCTAGGTCCAAACGTACTCCTCGGCGTAGGCTCGGAAGGCGTGGTCCT AGTCAGGCCGGCAGACAAGGTGGTGCTAGCTGAGTACCCTTACAGCAACA TTGCTGCACTGCTCATGGACCCCGTGGATAATGGGCTCACCATTAGTCTC ACGCACCATGGACAGCATGACGGGCATAGGTAAGATTACGTGCTATAGTC TGGTCTATGAGCACGTAGAATGCTCACAGACCGGGCTTTAGTTTTTAGTT AAGTAGTTAGACTTGTTTTAATTTAGGACTTACGCGAAAACTTGTGGGTG CACGGAGTGGATGATGCACTACCGTCTCCCGCCGCCCCTATTAAACATAC ATGCGCTGCTCATACTATTCTCGACAGACAAGTTTTAACTTAGGCTATGG CTTTAAGCCGCAAAATCAACATAGCATCCTCAAGAATGTATTCCTTGCGG AGAATATTCTTTTAATGGTAATAAAGGCTGTGTTTTAGACAGAAATTGCC GGTAGACTTCACTGGAGTTTAATTAAAGTGAAAGTTTGCGAGGATGGATA GAAAAGCTGGTAATCTATAATTTTCCTATTTTTCCACTCAGATGCATAGT CCTCGAGTCTCCCCAAAAGAACGAGGCGGCTTGGCTAATGGCAGCCTACA GCCCAGTGCTAGCCAACGGTTTAGCCGACGAGCCGCCGCGTCGCGCCGCA CCGGCATCGGAACGTTCGCGGCTCGCTGGAGCCCTAAAGAGCGCCCGCCG AGCGCTGGTTGACTCGGGCATGCTGAGAAGACCTACGGAACTGTCCGCTG GGAACTTCTTGAGGAATACTTTGAGAAGGTCAGTGAGGGTTATACACTAG TTTTTAACCAGCCCAATCTTACTGAGTGACTTTACTGTGACGCATTGTCT TTTCAACTGAAAAGATTTGGTGGACTTTTCAATGTGTAAGACGAGATAAA CGAGGAGTAAGGAATAGCCTATGTGTAGACTACGTTTTGTAACAATTTTG GGGTGAAGAATCAGTATACCTCATAAGATTTTTTTGGGAGAGAGAGAAGT AAGGCCGCTTGTAAATATCTCATCAGTAAATAAATCCTCTTTTTTTTTAC TGGACTACGGCCCGATTTTTTCACCGGATTAAGCGGTGGTGTATGGTTTA TAATGAACGTGTGCACATGCATCAGACTTGTGTCCGGCGAGAAAATTGAC AGCAAACAAAGGATATCCGTTTTTTGACGGTCCGCAGTTTACAAACGATC TAAGGCTTTTAACATTTCGGTGACTCCAAAATATTATTTTCCCTTCCAGA CTAAGCAAGCACCGTCTAGAGAAGGTCCGCCTAGACATGGCGGCAGAAAG TCAGGAAGAGTGCTACAAGAGCTTCCCGGCCGGCTACTGGCGCTGGTCGC GCTCGCTGCCGCACAGCCTCACCAAGCTCAACGAGGCCGAGGAGGTGGCC GCCATGCAGATATTCAAGGTGGGCCTCGCTACAGCCTCCTCCAGTACCCA CCACCACCCATGGTTCTTCCTGCCTCACGGCGTACGAACCGAATCTCGGG AGAGCGCGCGGGTACTTGCTCTGGGCTCTTTTCCCGGGGCGCTTTGCTTG ACTCCCTACAAATTTCTCTGATCCANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNGGAGCCAGGAGTCACTAAGCTCAACGTGGGAAAAAA GGTGACCGCGATGCAGATATTCAAGGTGGGCCTTATTACTGTATCCTTTC CAGATATTCAAGGTCTCAATAAATCCTGTCTCCAGTCAAACGAGTCAAGC GACGGATAGACTTAGCGGCGTGGAGCCAGGATGACTCCTGGCTCCACCTT TTTTCCCACGTTGAGCTTAGTGACCTAAGCTCAACGTGGGAAAAAAGGTG ACCGTGATGCAGATATTCAAGGTGGATCTCACTATGTCCTGTCTCCAGAC TAACAAGCGCCAGCTAGAGAAGTTGCGTTTAGACATAGCAGCAGAGAGCC AGGATCTCTTGTCCTGAAGTGGTCATTAGAATAGGCTATAATTATGAGAC GTTGTGGAAATGCTCCAAAAAGGGTAAACATGGGGAGACGCGGGTGAGTG CGAGGGATAGTTGCATTCCAACGAGGTGCGCAGTTATCTCGACCGGGTAG TAGTAATAAAGAATTTTAATTACAATTTTATAAGTGGAAATTACTTTCAG GACATTATGAGCCACGCGGGTCTCAGCACGCAAGARGGCAGCACCAGCAA CCTGGCCAACAACAACAGCATCAGCAGCCAGGAGAGCGACAGCGACGACC GCGTGGCGCTGGCGCAGGCGCTGCTGCAGCGCTGCCTGCAGAAGGACACG CTGCTGTGCGAGCTGTACGTGCAGCTGATCAAGCAGGTCAGTGGTGACGT CACCAGCACCAGCGACCTGGCCAGCGACAGCAGCAGCAGCCAGGAGAGCG ACAGGATGACGTCACGCGATATTGTTTTGTTTCAGACCTGTGCGCTGTCT ACAGTCAGTGTCCTATGAATGTGGGCGATAGTGTTTTGTTTCATTCCTGA CGTGCGCTACAGAAGGATATACTTGTCAGTGACTAGTGGGCGTTGTCCAC AGAGTTATGTGTCAGACCTGTGCTGCCTTCAGAAAGATAATGTTGTGCGT GCAAGCTTTTCACGTGCAGCTGATAAAACAAGTCAAGGGACAGACTCGAC AGTGTAATGTTTCAGTTGGCCTTATCGCGAAAGTTTCGGAAGAGATTTGC TGACACTACTTGCATAAATGATAACACATTTGTATTTTGCCAACAGACGA CAGACCACCCAGAGCCGTCATCGCGCGTGTCCTCCCGCCACTGGGCTTTG CTATGCGCGGCCATCGGCGCTGCGTTACCGCCTGCCAAACCGCTGCGCCG GCTGCTATTAGCTCATCTACGGTACCGAGGCGCGGCGCTGCATACTGGCG AAGACGGCAAGTTTGCAAGACGTGCAGAACAGGTATGTAGATACTAATAA ACAGGTTCTCAAGTCCCAACAAACTAAGTACCACCCAGAAGCGTCATCTC GCGCGTCGAGAAGCCAATGGCTGTTACGGCAAAGCCGCTGCGCCGGCTGC CGCTAGCTCATCTACGGTACCGGGAGGACGGCATGTTTGCTAGGCGCGCT GAACAAGTAGGTTGATACCAATAGACCACAGACAACCTAGAGTTGTCTCT GGGCATTACTGTGCGCGGCTATCGGTGTTGCATTACCGCCCGCCAAGCCG CTGCGACGGCTGCTGTTAGCTCATCTACGGTACCGAGGCGCGGCGCTGCA TATGGGCGAAGACGGCAAGTTCGCACGGCGCGCTGAACAGGTATGTAGAT ACCAATAGACAGGTTCCCAAGTACTAACAGACTAAGTACCACCCAGAAGC GTCATCTCGTACGTCAAGCTGTCAATGGCTGTTACTGCCAAGCCACTGCG CCGGCTGCTGCTAGCTCATCTACGGTACCGGGGCGCGGCCCTACATACGG GCGAAGACGGCAAGTTTGCNATGGCTGTTACTGCCAAGCCACTGCGCCGG CTGCTGCTAGCTCATCTACGGTACCGGGGCGCGGCCCTACATACGGGCGA AGACGGCAAGTTTGCGAGACGCGCTGAACAGGTGTGTAGATACCAATAGA CAGGTTCCCAAGTACTAACAGACTAAGTACCACCCAGAAGCGTTATCTCG CGCGTCGAGAACCCAATGGCTGTTACTGCCAAGGCCGCGGATCCAGTCTT AAAAAAGTTTGTGGTCACATCACAAATACGAGGCTAGGGACCTCAACTGA CGGGGCATCTATATTGGTTTTATACAAAGCATAAGGAAAAAGACGCAACC TCTACACAAATCTAGATTTCTAATAACAAATCGTTTATCTATCAGTCTGG ATCATTAATATTATGGTAGGGTTTAATGGTAGAATCACTAGGCCCTTCCT TTTCGCGATCTTGTATAAAATAGTCTTGTAACACCAGTGCTGCAGTGTAA TACCACTGTAATATCTGTGTCTATGGATGTTACTTAACCCTATCAGAACT CTTACCCACATCCAGTCCTGAAATAAATTAATATCGTCTTCGCAGGTGGC CCTAAGCATAGCCCAAGTGCCCCGCCGTCTCGCCGCGCCCTCCAAAGAGG AACTGCTATGCGCGGCCGCGAGGAGACCTATGCACGTCAGGGTACTACTG CTGGATGGAAAACAGCACGGCCTGGTGTTTGGACCAGCGGCTACGGCTGA CCACCTGGTTACTATGCTGAGAGAAAAGATCGGCCTTAATGAAGCTGCCA CTGGTGAGTTATAATGATGACAGGATATTTATTAAACTACTATGCGCGGT CGCGAGGAGGCCTATGCACGTCAGGGTACTACTGCTGGTTGGAAAACAAC ATGGCCTGGTGTTTGGATCAGCTGCTACGGCCGACCACCTGGTTACTATG CTGAGAGAGAAGATCGGCTTGAATGAAACCGCTACTGGTGAGTTTTGATG ATGATGAGTGGGGATTCAAATGTCTTACGCTGCTTAGATTAAATGTCTTA CTTGTTCTAAATATATTTGTGTTTTACAGTTTGACTTCTCTTGGTGTTAT TGTAAATGTGAATATGCCTTTAAAGAACTACACAGGTACACTTTAAAGAG CCTACTCGCATATTAATTAGTAACCAATCATCTCATAATTCGCTCGCGTC TAAACGCACGTTGAATATATATTATTTTATGTTCTGACGTACTCCCTAGG TATTTTCTGTTAGGTCTAAATTATTTACAAAGAAATAAAGGTTGTAATTA CTTAGCCATTATTCCCAAAGTCATAGTGTCCAAGGCTAAGAACTCACGGC GCGATTTTCAACCGCGCCCGCGGCGGTTTTATTTCAAAACTCACGGGACC CGATTACAACCGCGCCCGCTGCGGGCAAAAACCGCGTCGTGAGTTGTGCA TTAGTTACATAAGTATCTGCATTTTACAGAAACTGCGGGCCCGCAACCGC TGCGGGCGAGGGTGAAAATAGCGCCATGAGTTCTGAGCCTTTTAAATATC TTTTTTTGTGTGTCAGGTTACGCGCTATACGAAGTGTGTGCGGGCACGAG CGCGGGAGCAGGGACGGGCGCGGGCGCAGCGGGCGCGGGTGAACGCGCAC TGGGCGGAAACGAGCGCGTGGGCGACGTGTTAGCGCGATGGGAGAAGGCT GGCGCCACCGCTGCGGCTTGCAGGTACAATGTGGTATTCGATGGCAACGC TAGTTTCCCCGGGCAGTTGTCTAACCAGTTAAACTATGCGGTGGCGAGTA CGGGTGAACGGGCGCTTGGTGACAGCGAGCGCGTGGGCGACGTGCTAGCG CGCTGGGAGAAAGCCGGCGCTACGGCTGCGGCCTGCAGGTACCGTGTGCT ACCTGATCGCCACTCCAGTCTGTCCCCAGCAGTTGTCTAGCCAGTTGAGC TATGCGGGCACGAGCGCGGGGGCGGGCAGACGCGCCCTGGGCGGGAGTGA GCGCGTGGGCGACGTGTTAGCGCGCTGGGAGAAGGCTGGCGCCACCGCTG CGGCTTGCAGGTACAGTGTGCTATCTGATAGTGCTGTTGTTTAACCAGTT GAGCTATATGAAGTGTGTGCGGGCACGAGCGCGGGAGCGGCGGCGGGCGA GCGCGCACTGGGCGGGAACGAGCGCGTTGGCGACGTGCTAGCGCGCTGGG AAAAAGCCGGCGCTACGGCTGCTGCTTGCAGGTAAGTTCCATCTAATGAG GGCTATCGTTTTTATACTCAACAGTTGGCACCCCTGGCGATTGACAGGAC CTTACTCTACAGTGGCGCCATCTTGATGAGTGCAAATGCGATAGTCCTCC TACCACTTTAGCGCTCACCAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN ATTCTTTTAAGGGCTGATTTTTCAATCGTCAGATAACTTTTAACTGAAGA ATAAGTTTGGCACAATGACAGTTTCAGTATGGGAAACATGTCAAAATGAC AAAGTTATTCTTCAGTTAAAAGATATCTGACGATTGAAAAATCAGCCCTA AGTTAGTGTTAAAAGACATTGTTAGCGTTAATTCTGCTACTATTTCCGTA GTGCAGTAATGGTGGCCTGTGTTGAAAATAAACAGCGCAAGAAAGACACT AAAAATAGTGTAGTGTAGCATTTTCAAAATTTTAGAAGATTCTGTTTTGT GGTCTAGTTCACACAAAAAATTCTGTAACATTTGTAGCTATAACTATAAT CTTTGACAAACGTCCATTCTGTGTGGTGGCTCACTGCGCTTTTTCTTAAC TAAGCCTTTTTGCCACCACAACGCACTTGCTATATTACCTGAAGCTAGAT ACTTTTTACGTCACATTCTGCACGAATAAATGACTAAACGAATGGAACAA ATCCCCAGGTTATGCTAGCAGCGCTCCACGCGCAAGTGGTAAGCGGCGAC TGCATGGGCGGCGGCGAGGAGTGTTCCGTAGCCGCTGGTGCCGTGCTGCC GCCGCGTCTTGCGCCTGCCCTACCCGCGCCCGCCGTGCGCTTGCATCATT TGGCGCTGCGAGGGACTGACGCCCATGCCGCCATGCAGCGAGCGCTGACG CTGGCTGCTTCGTGGCCGCTCGCGAGAGCCACTATCTTTGATGTCATGGT GAGTGCCAGCGCCAGCTGTACGACTGCATCATCTAGCGCTGCGGGGAACT GA
back to top

Coding sequence (CDS) from alignment at newscf_1990:25210..41561-

>OSCA000936-RA ID=OSCA000936-RA|Name=OSCA000936-RA|organism=Ostrinia scapulalis|type=CDS|length=5169bp|location=Sequence derived from alignment at newscf_1990:25210..41561- (Ostrinia scapulalis)
ATGCACGTTGCCGTAGGCATGACAGGTTGGGCCGTGTACCAGCAAAGAGG
CGGCAAGGAGGGGCACTTCAGAACCACGCAGTACTTGTATTACGTCATCG
CCGCTTGGGAAATGCAACAAGGTCCGGGCGGCGGGTCAGCCGACAACCGG
TTCGTATTCAAACGGCGGCTGTTCCGCGGCGGACGCGAGTTACCTCACGA
CCCAGTCGAAGTCGCCCTGCTCTATGCACAAGCCGTTCACAGCGTCGTCA
AGCTGGACGAGTTCCCAGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGG
CTACAGGCGCAGGTGTCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCC
ACACACGCGCGCCTACTACTCTCATCCCGACCAGTTCTTACCTCAGCGCA
TCGCTAGGGCGCGCCCGGCGCACCAGTGGTATACGAGAAGGTGGCATTAC
AACTGGCAGGGCTGCAGGCACAGGTGTCTCTTGGAGAACCTCCACCGAGC
CCGCCGCCGCCGCACACGTGCGCCTACTACTCGCATCCCGACTAGTTCTT
ACAGAGGGCAAGCTACAATCCTCGCCCAAGCGCACCGGCAGTACGGCGCC
GGGCGCGCGGAGCTGACGGCCAAGGCTTTATACCTGTCCTGCGTTATGCA
GTACCCGCTGTATGGCGTCACGCTGTTCCCCGTCACTTACAAGGGATATT
GGGCGCATGGTCCAAACGTACTCCTAGGAGTAGGCTCGGAAGGCGTGGTC
CTGGTCAGGCCGGCAGACAAGGTGGTGCTTGCAGAGTATCCTTACAGCAA
CATTGCGGCGCTGCTCATGGATCCCGTGGATAATGGGCTCACCATTAGTC
TCACGCACCATGGACAGCATGACGGGCATAGATTACGTGCTTACTTCTTA
CGCGAAAACTTGTGGTTGCACGGAGTGGATGATCTAGACAAGTTCCCAGT
ATCCGAGAAGGTGGCGCTACAACTAGCAGGGCTGCAAGCGCAGGTGTCAT
TAGGGGAGCCGCCGCCGAGCCCGCCGCCGCCACACACGCGCGCCTACTAC
TCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCGCGCCCGGC
GCATCAGTGGGTGAGTGTTATTGCGAGGGAAAAGGGTTCATTTTCGCCTG
GGGAAGGGACGGAGAGGGGTGTCTCTCTGCAACTAGACGAGCTCCCAGTA
TCAGAGAAGGTGGCATTACAACTGGCAGGGCTGCAAGCGCAGGTGTCGCT
AGGAGAGCCGTCGCCGCACACGCGCGCCTACTACTCGCATCCCGACCAGT
TCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACATCAATGGGTGAGT
TTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAGGCACAGGTGTC
GCTAGGAGAGCCACACGCGCGCCTTCTACTCGCATCCCGACCACTGGACA
AGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAAGCG
CAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACTACTCGCA
TCCCGACCAGTTCTTACCTCAACGCATTGCTAGGGCGCGCCCGGCGCATC
AATGGGCTACAATCCTCGCACAAGCGCACCGGCAGTACGGCGCCGGGCGC
GCGGAGCTGACGGCCAAGGCTTTATACCTGTCGTGCGTCATGCAGTACCC
GCTGTATGGCGTCACGCTGTTCCCCGTCACGTACAAGGGCTATTGGGCGC
ATGTATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCTGCAGGCGCAGGTG
TCTCTTGGAGAACCTCCACCGAGCCCGCCGCCGCGGCACACGCGCGCCTA
CTACTCGCATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCACGCC
CGGCGCACCAGTGGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTA
GGGCTGCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGC
TTACTACTCGCATCCCGACCAGTTCTTACCTCAGCGCATCGCTAGGGCGC
GCCCGGCGCACCAGTGGCTGGATGAGTTCCCAGTATCCAAGAAGGTGGCA
TTACAACTCGCAGGACTACAAGCGCAGGTGTCTCTTGGAGAGCCTCCACC
GAGCCCGCCGCCGCCACACACGCGCGCCTACTACTCGCATCCCGACCAGT
TCTTACCTCAGCGCATCGCTAGGGCCCGGCCCGCACATCAATGGCTGGAC
AAGTTCCCAGTATCAGAGAAGGTGGCGCTGCAACTAGCAGGGCTGCAAGC
GCAGCTAGGAGAGCCGTCCCCGCACACGCGCGCCTACTACTCGCATCCCG
ACCAGTTCTTACCTCAACGCATCGCCAGGGCGCGCCCGGCGCACCAGTGG
CTGGACAAGTTCCCAGTATCCGAGAAGGTGGCGCTGCAACTAGTAGGGCT
GCAAGCGCAGGTGTCGCTAGGAGAGCCGTCGCCGCACACGCGCGCCTACT
ACACACATCCCGACCAGTTCTTACCTCAACGCATCGCTAGGGCCCGGCCC
GCACATCAATGGGCGATATCAGAAAAAGTGGCGCTGCAACTAGCAGGGCT
GCAAGCGCAGGTGTCTCGCACACGCGCGCCTACTACTCGCATCCCGACCA
GTTCTTACCTCAGCGCATCGCTAGGGCGCGCCCGGTGCACCAGTCCAAAC
GTACTCCTCGGCGTAGGCTCGGAAGGCGTGGTCCTAGTCAGGCCGGCAGA
CAAGGTGGTGCTAGCTGAGTACCCTTACAGCAACATTGCTGCACTGCTCA
TGGACCCCGTGGATAATGGGCTCACCATTAGTCTCACGCACCATGGACAG
CATGACGGGCATAGATGCATAGTCCTCGAGTCTCCCCAAAAGAACGAGGC
GGCTTGGCTAATGGCAGCCTACAGCCCAGTGCTAGCCAACGGTTTAGCCG
ACGAGCCGCCGCGTCGCGCCGCACCGGCATCGGAACGTTCGCGGCTCGCT
GGAGCCCTAAAGAGCGCCCGCCGAGCGCTGGTTGACTCGGGCATGCTGAG
AAGACCTACGGAACTGTCCGCTGGGAACTTCTTGAGGAATACTTTGAGAA
GACTAAGCAAGCACCGTCTAGAGAAGGTCCGCCTAGACATGGCGGCAGAA
AGTCAGGAAGAGTGCTACAAGAGCTTCCCGGCCGGCTACTGGCGCTGGTC
GCGCTCGCTGCCGCACAGCCTCACCAAGCTCAACGAGGCCGAGGAGGTGG
CCGCCATGCAGATATTCAAGCAGAGAGCCAGGATCTCTTGTCCTGAAGTG
GTCATTAGAATAGGCTATAATTATGAGACGTTGTGGAAATGCTCCAAAAA
GGGTAAACATGGGGAGACGCGGGACATTATGAGCCACGCGGGTCTCAGCA
CGCAAGARGGCAGCACCAGCAACCTGGCCAACAACAACAGCATCAGCAGC
CAGGAGAGCGACAGCGACGACCGCGTGGCGCTGGCGCAGGCGCTGCTGCA
GCGCTGCCTGCAGAAGGACACGCTGCTGTGCGAGCTGTACGTGCAGCTGA
TCAAGCAGTTGGCCTTATCGCGAAAGTTTCGGAAGAGATTTGCTGACACT
ACTTGCATAAATGATAACACATTTGTATTTTGCCAACAGACGACAGACCA
CCCAGAGCCGTCATCGCGCGTGTCCTCCCGCCACTGGGCTTTGCTATGCG
CGGCCATCGGCGCTGCGTTACCGCCTGCCAAACCGCTGCGCCGGCTGCTA
TTAGCTCATCTACGGTACCGAGGCGCGGCGCTGCATACTGGCGAAGACGG
CAAGTTTGCAAGACGTGCAGAACAGATACTAATAAACAGGTTCTCAAGTC
CCAACAAACTAAGTACCACCCAGAAGCGTCATCTCGCGCGTCGAGAAGCC
AATGGCTGTTACGGCAAAGCCGCTGCGCCGGCTGCCGCTAGCTCATCTAC
GGTACCGGGAGGACGGCATAGTTGTCTCTGGGCATTACTGTGCGCGGCTA
TCGGTGTTGCATTACCGCCCGCCAAGCCGCTGCGACGGCTGCTGTTAGCT
CATCTACGGTACCGAGGCGCGGCGCTGCATATGGGCGAAGACGGCAAGTT
CGCACGGCGCGCTGAACAGGTGGCCCTAAGCATAGCCCAAGTGCCCCGCC
GTCTCGCCGCGCCCTCCAAAGAGGAACTGCTATGCGCGGCCGCGAGGAGA
CCTATGCACGTCAGGGTACTACTGCTGGATGGAAAACAGCACGGCCTGGT
GTTTGGACCAGCGGCTACGGCTGACCACCTGGTTACTATGCTGAGAGAAA
AGATCGGCCTTAATGAAGCTGCCACTGGTTACGCGCTATACGAAGTGTGT
GCGGGCACGAGCGCGGGAGCAGGGACGGGCGCGGGCGCAGCGGGCGCGGG
TGAACGCGCACTGGGCGGAAACGAGCGCGTGGGCGACGTGTTAGCGCGAT
GGGAGAAGGCTGGCGCCACCGCTGCGGCTTGCAGGTACAATGTGTTAAAC
TATGCGGTGGCGAGTACGGGTGAACGGGCGCTTGGTGACAGCGAGCGCGT
GGGCGACGTGCTAGCGCGCTGGGAGAAAGCCGGCGCTACGGCTGCGGCCT
GCAGCGCGGGGGCGGGCAGACGCGCCCTGGGCGGGAGTGAGCGCGTGGGC
GACGTGTTAGCGCGCTGGGAGAAGGCTGGCGCCACCGCTGCGGCTTGCAG
GTACATTGAGCTATATGAAGTGTGTGCGGGCACGAGCGCGGGAGCGGCGG
CGGGCGAGCGCGCACTGGGCGGGAACGAGCGCGTTGGCGACGTGCTAGCG
CGCTGGGAAAAAGCCGGCGCTACGGCTGCTGCTTGCAGTTGGCACCCCTG
GCGATTGACAGGACCTTACTCTACAGTTATGCTAGCAGCGCTCCACGCGC
AAGTGGTAAGCGGCGACTGCATGGGCGGCGGCGAGGAGTGTTCCGTAGCC
GCTGGTGCCGTGCTGCCGCCGCGTCTTGCGCCTGCCCTACCCGCGCCCGC
CGTGCGCTTGCATCATTTGGCGCTGCGAGGGACTGACGCCCATGCCGCCA
TGCAGCGAGCGCTGACGCTGGCTGCTTCGTGGCCGCTCGCGAGAGCCACT
ATCTTTGATGTCATGGTGAGTGCCAGCGCCAGCTGTACGACTGCATCATC
TAGCGCTGCGGGGAACTGA
back to top
Synonyms
The feature 'OSCA000936-RA' has the following synonyms
Synonym
maker-newscf_1990-snap-gene-0.48-mRNA-1