OSCA002369-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA002369-RA
Unique NameOSCA002369-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length567
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2005contignewscf_2005:59832..84034 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.74
QI0|0|0|0.4|1|1|5|0|188
AED0.74
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA002369OSCA002369Ostrinia scapulalisgenenewscf_2005 59832..84034 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002369-RAOSCA002369-PAOstrinia scapulalispolypeptidenewscf_2005 59832..84034 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002369-RA:cdsOSCA002369-RA:cdsOstrinia scapulalisCDSnewscf_2005 59832..59987 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002369-RA:exon:849OSCA002369-RA:exon:849Ostrinia scapulalisexonnewscf_2005 59832..59987 -
OSCA002369-RA:exon:850OSCA002369-RA:exon:850Ostrinia scapulalisexonnewscf_2005 67802..67882 -
OSCA002369-RA:exon:851OSCA002369-RA:exon:851Ostrinia scapulalisexonnewscf_2005 80995..81071 -
OSCA002369-RA:exon:852OSCA002369-RA:exon:852Ostrinia scapulalisexonnewscf_2005 83377..83449 -
OSCA002369-RA:exon:853OSCA002369-RA:exon:853Ostrinia scapulalisexonnewscf_2005 83855..84034 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA002369-RA ID=OSCA002369-RA|Name=OSCA002369-RA|organism=Ostrinia scapulalis|type=mRNA|length=567bp
ATGGTTGGCAGTCCACAACAGTGCGTTACTCTAGAAACTTCCTGCACCGT
ACAACCAAACTGTAGAATGGACTGTCGTCTGCGGTGTTTCCGGACCGATA
CGACCTGCAAGCTTTCAAGAAGAGAGCGTATCTTCACCTTAAAGGCCGGC
AACGCACCTGTAACGCCCCTGGGACTGCGGGTCGGGCACGTACGGCCCTT
CGGCGTGGAATTCGGCGTCCAATACAAATACTTCTGGCTTCACCGCCGGC
TAGTGGAGCTAGAAATAGAAGCTGATAAAGGTAGCAGGAAGGCGCGGGAT
GCAGGCCGCTATCAACCGTGCGATGTGGATAGTCAACTGTGGGACGAGTT
TGAGCTAGAGGACGCCACCTTCGCCGAGTGCAGCATCAATAACGCCAACA
ACAGCTTCCAAATTATTGTCGAGGTTAACGATGCTAGGAAAATATACAGG
GTGAAGTATGGGACTTTACTAGAATATACAGGGCGAAAGTATGAGACTAC
CCTGTATATTCTCCTGGCATCGTTAACCTCGTCCTGTCTCACCGGCACAT
TCTGCCGCAGGTCATGA
back to top

spliced messenger RNA

>OSCA002369-RA ID=OSCA002369-RA|Name=OSCA002369-RA|organism=Ostrinia scapulalis|type=mRNA|length=567bp|location=Sequence derived from alignment at newscf_2005:59832..84034- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGTTGGCAGTCCACAACAGTGCGTTACTCTAGAAACTTCCTGCACCGT
ACAACCAAACTGTAGAATGGACTGTCGTCTGCGGTGTTTCCGGACCGATA
CGACCTGCAAGCTTTCAAGAAGAGAGCGTATCTTCACCTTAAAGGCCGGC
AACGCACCTGTAACGCCCCTGGGACTGCGGGTCGGGCACGTACGGCCCTT
CGGCGTGGAATTCGGCGTCCAATACAAATACTTCTGGCTTCACCGCCGGC
TAGTGGAGCTAGAAATAGAAGCTGATAAAGGTAGCAGGAAGGCGCGGGAT
GCAGGCCGCTATCAACCGTGCGATGTGGATAGTCAACTGTGGGACGAGTT
TGAGCTAGAGGACGCCACCTTCGCCGAGTGCAGCATCAATAACGCCAACA
ACAGCTTCCAAATTATTGTCGAGGTTAACGATGCTAGGAAAATATACAGG
GTGAAGTATGGGACTTTACTAGAATATACAGGGCGAAAGTATGAGACTAC
CCTGTATATTCTCCTGGCATCGTTAACCTCGTCCTGTCTCACCGGCACAT
TCTGCCGCAGGTCATGA
back to top

protein sequence of OSCA002369-RA

>OSCA002369-PA ID=OSCA002369-PA|Name=OSCA002369-RA|organism=Ostrinia scapulalis|type=polypeptide|length=188bp
MVGSPQQCVTLETSCTVQPNCRMDCRLRCFRTDTTCKLSRRERIFTLKAG
NAPVTPLGLRVGHVRPFGVEFGVQYKYFWLHRRLVELEIEADKGSRKARD
AGRYQPCDVDSQLWDEFELEDATFAECSINNANNSFQIIVEVNDARKIYR
VKYGTLLEYTGRKYETTLYILLASLTSSCLTGTFCRRS
back to top

mRNA from alignment at newscf_2005:59832..84034-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA002369-RA ID=OSCA002369-RA|Name=OSCA002369-RA|organism=Ostrinia scapulalis|type=mRNA|length=24203bp|location=Sequence derived from alignment at newscf_2005:59832..84034- (Ostrinia scapulalis)
ATGGTTGGCAGTCCACAACAGTGCGTTACTCTAGAAACTTCCTGCACCGT ACAACCAAACTGTAGAATGGACTGTCGTCTGCGGTGTTTCCGGACCGATA CGACCTGCAAGCTTTCAAGAAGAGAGCGTATCTTCACCTTAAAGGCCGGC AACGCACCTGTAACGCCCCTGGGACTGCGGGTGTCTATGGGTGACGGTAA TCACTTACCATCAGGTGATCCGTCTACCCGATTGCCTCGTGTCATAAAGT GAAATGCGTACACTAGAGATATCAGCGATTCGTTGTTAACTTGCAAACAA ACAATACCAATTCACAGTAAGAAACAAGTCTATCATCATCGTCATCATCA TTTCAGCCACAGGATGTCCACTGCCGACCATAGGCCTCCGTCAATGATTT CCAGCTTGCATTCAGCGCCTTCCTATTACCTTTACAAGGCCGAAAAAGCT CTATAACAGAGTGATATTATATTATTATATCAAGCAAATCTCAAATTCCA AACCTCATCCAACTTATTGAAATAAAGCCGTAAATACTGAGAGCTGACAC GAATTTGATCGAGTTGAAATTATTTTCTTTAGCAGGTCGGGCACGTACGG CCCTTCGGCGTGGAATTCGGCGTCCAATACAAATACTTCTGGCTTCACCG CCGGCTAGGTCAGGTAGTAGCGCCAGTAGAGGTTGGCAATCGTGTGGACA AATGCTAGGCAACTTAATATTGACAAATCCGGAAGACGTACTGTGGGCAG TCCCCCACTAGGTGGACCGACGATTTGGCGAAGGTCGCGGGAAGTACCTG GATATAGGCAGCGCAGGACCGGTCGTTATGGAAATCCTTGGGGGAGACCT TGGTCCAGCAGTAAACGTCATTTGACTGAAACGAACGAAAAGATTGGTCN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNAGAAATAGTTCTATTAATAAAGTAATGTAAGCCTTTTTTTG CCTGAGATACAGGAATTATAATTCTTAGTTCAGGCACGTATGTACTTTTA CCTATTATAGTTTAATATTAGCCTATTGTTAAAAACTGTCAATAAGTTAT TCAATAAAGAATTTATTTATTTATATTATTTATTGAAAATGTACTTAAAG TACTCATTGGATTGTCAGGAGTACGTGCTTCGTTTATATTTACTACATTA GACGGGGACTGTACTCGTGTCTCATACGATCAAGCACTCAGCCTAACTGA ATAAAACTTTACTTGAAACTTTTCGATCAGTACATACTAAACATAATACA TTTTCTAAGAAATTTCTCAGAAAATATATTACCTAATCGACTGATAACAA TTTGATAAAGTATATTTTCTAAGAATAACTTTATTTGTAATCAAGTTGTC TTTTATTTTACCTGAACATTGTCTGCCTCATTTATAACTATGTTTTCTAT AACTAGGGGCATGTTCCCGCAAGTTACATGGGACTAATTACCTGCGAACC CGACCCAAGACAGACAAAATACATCAGCCAGTTACATGGCCAAAATAACT TGACCTTTTCACATAGAAGAGTACCTACTTGTATGTATTAATTCAACAAT ACCTATGAGATTGTGTGCAAGATCTAAAACTTAACCTTCAAAAATGTACC TAACTACATTAAATTTACAGTTCAGTGGGTGTGTATCTACTGGTAATTTA AAAAGTGTTTAAGATAGCTTTTAATAATAAATGTAGCGTATGACAATTTG CCTGAATTTTATTTTTGATGTGTTATTTAATTAGAAATGCTGTTCTTAGC TATTCATTTTAAGGTCATTGTTTATTTATCTAGGGATAGTTCACAGCACA ATATCAGTTTAGGTTGCAGTATGTTTTTGTAAGATTTTGTAGGCCAATTA TGTATATAATTTGTACTGAACTTCCCAGATTTATCCCATTCGATGGTTAT TGATTCAGATGGGTAAACTCATTTGGACATTAGTCTTAAATCTTCGTTCT TGGCGTGAAAAAGAAAACAAAGGCTTCCCGTGGCAAGTTCTAGGTCATCG GAATTTAGGCGAAGGTTTTCCTAATCTTTCTTTGATAAACCATACTTTAT GAGAGCAAAGCCGCGGTGACAGGCTAGCTACATAAATTTCTTTCAGTCGA GATTACCAATTTCAGGCAAGACAGCTCTTTATTCCTAGATTTCCATAAAA ATGAAAGTTGATTGTGAAATGTGAGAAGGGGAAAGTGCCAATTGGCGGCT ATATGCTCCATATTTTATGAAAAGAGCATGCGAAAGTAATAAATCATACG TATTATTATTCAGTGGAGCTAGAAATAGAAGCTGATAAAGGTAGCAGGAA GGCGCGGGATGCAGGCCGCTATCAACCGTGCGATGTGGATGTCATTGGGG GAGGCCTATGTTCAGCAGTGGACGTCCTGTGGCTGAAATGATGATGATGA TGATGATGAAGCTAGAAATTGATTTATTGTGAAATTACTTTTCTAAACAA GGATGAATAGAAGTACATCAGGGGTGGCCAACATGATAAGACATAAGATG TACTGTTTACTAACGAAACCCTGGGCAATCTACCACTTACATACTTCTTG AAATCTTAAATGAAACAGCATAGTTTACACAATCATGCAGTATTTTTTGC CTTGCCAGGATCGACTGGACTAATAGTCGCGATCATTTTAATAGGTACTA TGTTTCAACTGAAATGTTATACATTGACTGTAGGTACTTCATCGCCAGCA TGGATTTCACATTCTCAATATTTTTTTTACATTTTTAGCTGGAATTTAAG TTAAAGCAAATGGAACAGATGTATTAAAGCAAATGGATCTTTAATGGTGA AAGTATTTAGTTACACTTTGGTGTTTTATGTAGTCGTATTTTACCTTTTT GCAACCAAAAAGAATGACTAAGTACGAAAAGAAATTAATTAAAATACACA GGTTGTAAGGGAAAGGCAAGGAAAAAATTAACACCAAACTGCAATTAGTG TCAAAAACTCCAACCATTAATTACTTACTTTATTTCCTAAATGTTGTGAA WGATTAATGCTTTTATTTACTTATTTGTTTGTCGCTGAAGCCGACATACT GTTTCCGCTTACTTACCGTCTACGTTTCTTAGTTACAATAATTTATCGTC CATTAATTGATAGTTCAATATTATTATGTATAGTTGCGACGACTATTTTA AGCAAAGTAAAAAAAATGAAATGTGAAAAAATGAGAATTTTCCGAAAATA AATCGTCACTATTTTCCAACCAACGCAGAGTACTCTGAATTAATTAAGTT ACTCCACATCAAACAACTCTACAATCGCGGAAAATTCGCATCATAAAATG GAAGTCGTTTATTGCATGCCATTTTAAGTAATTACGTAAGATGTAAGCAC AAGCAAGTCAAAAACAAATTGTTTTCTGCATATAACTAAACAAGCTGTCG CATGTAAATTGGTTCTTAACTTTGGTTTGCTAATTCAAAGTGCAAACCAC TATCGTTTCAGCACTCTGAATATGCATGGGAGGTCCCAATTAATAGTACC TGTACATCACGACGTCCTTCGACTACGACGTTATTAGTTTAATTGTGCGG GAACTCGATAACATCATCAACAATATCTTTAACACTGCAGTACATGTACT GAATAAATTATTTATCTACGAGATTAAATAGATAAATGTAATGTGTCTGT TTAATATATCAATTTAAGTACCTACATAATGAGTTATTTATTCGCCTCGA CCGTGCATCAAACAAAGTTTTTTATCCACAACGAGGAACTTCTTGGCCTG CATGCCTGCATCTCACCTGAAGGAAATTTTTCGATCAAATTTTGTTGCAT ATTAACTCTTATTAAAACTAAATAAGATGCCACAGTGAGTAGCTTGAAGT GCCACCCGTAATTAGTGTAATAACACTGGAGTAATTAATTCACTATTTCT TAACCTATATTTAAAACCCACCTCTTTATTCTCTATAAAAGCTTTTAAAA CAACCCATTGGGTGATTGAAATCAAATATTTTGAAAGCCGGTGCGGTGTA GAGCACTCGATATATGCCACAAAAAACTTTTTTCTGCGTACTCACGTCGG ATGGTCCGGGAGTAATCCATCACCATCGGTTCGTTTCCCTTCGGCCTGGA GCGAAAAATGACGAAATATTGTTTACATCGGAAGTGCCAAATGTGGATGG GTACTTCTCATTTACACTCAAATTTGATGGTCACACAATAATAGTTCATA AACGGTATAAGTTAGAACAATAACTTTGAAATCAGATGATAAAATATCTA TTTAGCTACATACAAAATAAATTTTATCGTAATAGAAGCAAAAATAATAC GAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNGAACATTACTATAAAAACTACCAACGAAA ATTGTTTTGAACGAGATCTAGCAAGTAGTTTTTTTTAATACCTCGTAAAT CGTTTTTATATAATATAAATCGTAAACCGTTTCATTAAATCAACTAAAAT ATAAAAATAAACAAAAGGCCTTTAATTTCATAAATCAATGGTACGGAACC CTTTGTGCGTGAGTCCGACACGCACTTGGCCGGTTTTTCCTGGGAACATG TGGAGTTACCAAGTTCATCACAAAAAATAGTTTTTGCGATTAGGTACAAA CATAATATTATAAGATTTTATCGCGTTCCATTTCAACTAAAATAGAGAAA CACGGGTCTCAACGTCAAGCAGCCGAAACGTCAAGCAGCCGAAACGTCAA GCATTAATTATGTAAGTCATATAAAAAATGTTGCGTTGAGACCCGTGTTT TTTATTTTAGTACCTACAAACCTATATACTTACGTTTGTACGGAATCCTC GGAATCCCGACTCGCACTTGCCCGGTTCTTTTATTTAATCGTAACAGAAC AACAAGCCGGTAATTCATTTTCCTGATTCGTATCAAGATTAGGACGTGAC AACCACAAACAAGGAGGCCGCTCTATGACGATGTTATGCTTTGTATCTTT CTCTAACTTACGGCAGGGGTCAAGATTGAGCGAGAAAGATAAATAGAGCC GATCATTTCAGGATTGTTTTGCAAAGTAAGGCTTTGACTACAGATTAGGG CCGTGAGAAATATGCCATTTCACGAGATGGATGGGCGACCCATCTTGTTT ATGTATGAGCTCATGCGATTGGACAGACAAAATATAAGGCGTCAGTTTTT CCACGTACTGAATTTGGAAGCAAAAATTGCCTGAATAATGCACAGTATGA ATAAGATAGCTGCTTGAAATATAGGTACGATCAACATCATCATGCTATTG CTCTTTTTGTAAATTAAACAATCCTACATACCTGCTTCAGTTCACTGCCT TAACTACGCACTCCTTCTCTTTACCTACTTCTCTACGAGTATAATTAATC AGAATGTTTACAATAAATATTGGGTCCCCGCAGACTACAGTATCTTTATC GGCCGATAGTATGATTGGCTTCTAAGTATGAGGAATCGGCCGATACTAAA TCGGTGAAATGTGGGCACTTCCATGTTTAAAAACCTTGTGGTCGTCGGGG AGTCTTGAGCCAGTTAAATAGTAATATGAGTGGTTATAAAGTAACACCCT AAACCAGCACTGTCTGAATAGGCGGTGACTACCTGATACAGGTATACTTT TACTTAATGGTATGTCACCACATTTTTTGTAAAAAATAGTTTGTTAAAGA ATAAAACATTTTTGATTTTTGATAAAAAATTCATTTAAGCGATAGTGACA TCAAACAAAATATGCAGTAAATTCTTCGTGTAGGTTCTTGAAAATCCGCT ACGTTTATGAATACAATATTATTGTTCTTATATTCGTGGTACGTGAAGGT TTGTACTGCATATTCCCAAGAGCTTAAAAACACACGAACGAAAATACTGA AGCGAAATATACCTTTCCATGTTTTGATATATTTTTTTATTATTTCTGTT TCGTATTATTAAAGCTCCACTCCAAAATGTGATTAATAATAAACGTAGAG CTAAAAGCACTTCGCACCATTTTATAGTTGGTTAATTAATATTGAAAATT CATTAGCAGAGTTTAATAGAGAGAAGATTTTTAAAATCTTTGTTTTATGA CTTTCGCTTGTACAAAACAATGCTCAAAAGTAAATCAAATCAAACCTTTT AATTTGAGATTGAGCAGTGTTTTGAGTTTTCTTCTGTCTTCTTCTTTGTT CGTATTTTTGGGTATTTCTAGCCAAGTTTTATCACTGTGCTTTGTTAAGA GCACGTTTCGCAGTCACATTACTTCATTACGTATCAGTTACTTTATTAGC TACGTTACAAAGCAAGGGCTTAATTACACAACACATGCCTGCTAATCTTT TGAGCCGTACTCCTAGCTTTGAGAGCACATTGTGATGTATTTATTAGTCA CAGTATGAAGAGAACAGCCAGTTAAACTAAAGTCAAATGTCACTTGTAAT TTTAAAGACGTTTAAACTTGTTGTTGGAGTGATTTCAGGTTTCAACATAT TACAGTTTTTACTTGATCATACTTTTTTAAAGTTGTAATTAGAATAATTT ATAATTTTAAGTACATAATGGACCCACAAGGTGGACGGATGACATCATAA AGGTAGCAGGAAGGCGCTGGACGCAGGCCGCTACCAACCGGGCAACATGG AAAGCATTGGGGGAGGCCTATGTTCAGCAGTGGACGTCCTATGGCTGAGA TGATGATGATGATGATAAATGGATGCAATAAAATGAGGAGTATATTATAG ATCTAACGCTTAACTGAGACAATGCCTAAGATATGGNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNCAGGCACTGACTCAGTTAAACGCTACCTATAGAC CTAAGTTTTTAGAGACAAGATGCGATGTTATCAGCCTTTAGGCCTGAAAG GTTGTTAATTTCCGTTATCTTTGATTCCTTTATCGATGACAAAACTTTAG TGTATCTCACTAGTTCTTTAGATGCTTTTGTCTCAATTAAGAATCTTCGG TAGAGCAAATTAACCACTTTAACATAAAAAAGACTTAAGTTAAATGGGCT GCCTGTTCTGTTTATTCTGACCACAAGTCCTTCACGCACCACCGGATCAT AATGCTATTCCCGCCGGTGGCTGCGCATCTAACCACTGTGTCAGATGCAT TGACTGTGATTATGGCATACTAGCGTCTGTCAGCGACTTTGCCTACGAAT TATGATCTCTCAAATAAAGTCCTAAATGCAGGCACGTTTTCCGATTAACC ATTATTATTATTACCAAAAGATAAATAACCCCTCACATGCCGCTCCCATA TCTTAGGCATTGTCTCAGTTAAGCGTTAGATCTATAATATACTCCTCATT TTATTGCATCCATTTATCATCATCATCATCATCTCAGCCATAGGACGTCC ACTGCTGAACATAGGCCTCCCCCAATGCTTTCCATGTTGCCCGGTTGGTA GCGGCCTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATACT AACAAGTGAAGTCAATATAAAGCTTGTAATAATAATAAAAAATAATTTGA ATTTGATCATACAGCCTAGAAGGAACTTGCTTAATACTCCCTAATGACAT TTCAGTAATTTCAAATATGTGTATGAGAGGGCTCATTCAAAGCAAAATAG GCGACAGGGTTGTCTTTTGATTTTTTTTTTTGCCTTGTTAAAAACAGAAC ACAAAATGTTTGGTTAAAATCTTTTGCGTGTCAAACTTGAGGTAGAAAAC CTTCTGTACCTGCTTGCGTTAGGGTCGGAGTGTTGTGAATAATTAAAGTG AAATACGCCTCGGGGTTGCCACTCGTCGCCCTAGCACGGCAATCCAAACT GAAATGGTGCAAATGGAGAAACTGACCTATTTACGAAGCCGTTCTTGGTT GCGTAACATTAACTGATTTGGACGTTGGATGGGTAATTAAACAACCACTT TTATACTAAGTAGTCATAATTAGAATTGCATTGCAATCTGCCAGCTAAAA CCCACAGATACATGTAAACCTCACTTTATACGGTTGAACCTTCTAACTTT GCCATCTATGTATATTTATGAAGTTGCGGTCTTCGTCAGACAAAACCCAA CATTATTCAGAAGTCATCACAGATCACGCGACAAGAATTTAATATGTAAG GATCCTTATAAGACAACTTTTTTTGCTAAGAATATTGTAGGCATGGCACC CAAGATTATAAATAAATTACCAAAAGACATTAGATTAATTGAACATCTAA ATTCATTTAAAAAAACTTTACTGACTTATTTAATTAATAAATGTTATTAT AATATATCTGAATTCTTTGACGATAAATCTAATTAGTTTATGTAACTGCC AAATTTTATTGTTGTCTGACAAATTGAGCGGAACATAGTGATACTACCTA ATGTAACATGTCACCATTTTACCTATGATTCACAATAAATGATTTTGTAT TTGTATTTGTATTTGTAGAGCCATTGTACCTTTACCCATAGCCTAGGCGC AGACCAACGATTTTTTTATTGGTCGATAGTTTAGTCGGGCAGTTAATCAC TATGGGCAATTGGGCATGTATGAAAGTGCGCACATTACACCGATTTGCTA TTCTTCATACAAATTAAAATCGGGCCCAACTATCGGCCAACTAAAATTGG TCTGCGCCTAGGCTTACAGGACTAGTTAGGACTTATAATAAGATTTTAAA CTTTCGACGACGCGGCGCCGCAAGCCGCCAGTCTGCTTGTGACCACGGCT GCAGCATAAGTAGCAGCCGAAACCGAACATACATTATAAATGTACTCATA TAAAAAAAAATTCGCGTTGAGTCCCGTGTTTCTCTATTTTAGGACTAGTT ATGTCAATTAACCACGCATTTTTATCGATAGAAACCAACCAGTACCTAGC AACCAAGATTTAATATTCGTTTCCTCGACGGTTCCGGAACAATTGAAAAT TCAAAGCATTCCGTTGCTGTGTGCTCGAATAAAGGTAAATGCATTCAACC GAAAAGAGTTTTGTTGCTCATGCAAAAAGGCTTAAAATTGAAAAGCGAGT ATGCAATCGTGCAGGCCTTTGGGACGAGTATGCTGTTATTTGAAGCAGAC AATCGTTGAAGAAAGAAAACGGTGATGTAGGAAATGTACTGGAATTGTGA ATTATTTTTTCATCTCTTTCTGGCATGAATTGCTTTTTTTATTAATGTTA CACAAGGTTACATGTAGGTACCTAAATGATAGTGCCTATTTACTAAAGCA AAGGATCCCCAAGGCAATGTTGGACTCACTTCACTCTGGCTTTTTCATCA TCATTATCATCATCATCATCTCAGCTATAGGACGTCCACTGCTGAACATA GGCCTCCACCAATGCTTTCCATGTTACCCGGTTTGTAGCGGCCTGCGTCC AGCGCTTTCCTGCTACCTTTATGTTAGGGTTATACAATTCAGCTTCATTC TTTATTACTATCATACTTATTGACGTAGACAACATCAACAGCTTCTGATA TTTAAAAAAATCGCATGAATTTTTGTACAAAAATATTTAATAGACGTACT TACCTGGTTTACTGAAAAAGTTAATTGCTGGAAAATCAGTAAATCAACGC TTCACCAAGAGCTTTTAACAAGCATTGTTAAAATATTGGATCGCCCCAAA ATACCTACTCCATCGATAATATTTACCTCCAATGAAAATATTTACCTTTC AGAGGCTTAAAAAATAAGCTGTCGCTATATCGATTTTTATATCGATAGAG TTATGTAAAAACTAAATAAATTAATAAACAGTATTTTTAAATTAAGTTAA AATAAAATAAATTAATAAACAGTACTAATCTAATAATCTTGTCATAATTC TAAGACAGTAATAATAAGCTATGCATTTATTAACACGTTGGTTGCTACAT GCATAGAATAAAATATACAATAATTTATTAATGTACTAAGTTGTTACTGG TATATTATTTTAAATAAGGTATCTTCTAAAATATAATGTAGCCTGTTAAT AAGTAAAACAAGGGTGATCACAGTTAATAGCTTTCTAGTACCAAACAAAC CAAATGATTAAGATGGGTGGGACGTATGAGATGAATTTGCATTTAATGTG TTATTTCATAGCACTTCGATTTAAATTATATATTATTAATTATATATTAT ATTGAAAATTTGACATGTAATGAACATTATGAATAAATTTCTTATTCTTA TTCTTATCGATGACCTGGAAATAACGCAAATATCGATATTTTTATCGTTT CACGAACTCAATTAGCAACACTAATCGCTTGCTGTTTTCTTAATTGATAT GTTTTTGTTACCTCGACGTTAATCAGTTTTATAAAATCTTAAGTAAGAGG TTTTTATTCATAATGCCCCGGTTTTTTCCTTTTAAGAAAATTCGCGATCA ATTTGAGTAATATTTTAATGTTATTTCTTAACGAGAGTTTGTTAACACCT TAACATCTCGTGGATTTAAATGCTTTTTATTTACAATTCTTTGTTGGTAA AATTTTATATAATCTAAGGAGAGAATATCTGAGGTGGGTATTACACAACG AAGCTCAAAACTATCAATCAAATCAAAACCCTTATCACCGAATAGTTTTT CCTTATTTTCTTCTTTTTGCAGCAAAAAGAATTTTAACGATTTACTCGCG AGTGGGACACGGTCTATGCTCTCATAACGGCTGTTGACATTATGTGAATA GTGATTCAAAGTCCTTCATTGATGCCGTTATCGATAATAAAGTTTGAATT AATTCTACGTCTCTTTAGGAGGAGGGAAGACTACAAACTCCAAACTCTAA GACTTGTTGACCTGTACTTTGGTCGGGCTGTTAATGCTAATTCCTCATAC AAATTAGAAACCGACCAAACTATCGGCTTATAAATATTCTGCGGGGACTC TTACATAAGTACGTAGTTATAATCAATATCAAATAATTCCAAGACACGAG TTCTATAAATAGGCACTTCATTATGACACTGAAAATCTGATTAATTTTCA GTTAACTATAAATTTTCGTTGCTGAAACTAGTCAATAGTCTGTAATTTGC AAATAAGTTACGTGCGTCACAGGTGTTTATAAACGAGTGAGGGCGATGTG TTTTGACAGCTCGTATAGTATTTAAATTCTAGATTTCTAGATGGTGTTTC GCTAGGGATAGGGATAAATCATATGAGTTCGAAGAAAAGAAGATTTCTCT ACTATCTGCCTTTTATCTAATGGACTATAAACAATACGAATAATATAATA GTGTCGTCTCTTTTTTGTGTATTTTTTTTATTGTCTTGTGCGGTGTGAAA TAAAGTGAGCTCTGTCTATCTAGCCTTTGTGCTTTTGAATCTTCGAAAAG GTATTTGTCTCTGGGAAGGTATCGATGTTTTATCCAGAGTGACCTATCAA GCTACATCACTAATCCGAAATGTCACGCCATTATAAGGCGCTCTGGGAAT GCCAACTGCGCCAGGTCGTTAAAACGGTGTACAATAAATAATTAAATACG AGAATGACGCGATGTTTTGAATATAGAACCTTTAAATGGGACTTATTTGA TACGCTTGAATAACATGAGATGTGTTTACCTTTAGAAAAACAAAAATAAA CTTTTTAAAAATAGATGACTTTGAGAACGTTCATCTCTTTGAAAACTTAA TATACGAGCTCGCAGCGTACCAAGAGTATATAATTACATAATACAGGACT TATGTAACGTGAATTTTCTCAATTGTTATGAGCGAGTTTAAAAATTTATA ATTTCGAAGGGTTTACATATTTTTCGCTATTCGTAATAACACTGCTTCGA GTTCGGAATTTCGGATAAGCCTTTCGATTCAATGAGTTAATGTTATAATT TATCTACAGGACATTAATGATTCGCCCGGCTTTGAGAACTTTAATTTTTA TATGTTAGATAATTTCTATAAAAACCTATTGTATTGTAATCTATGTGATG TTCATGCTAAAATGGCAGTTTCCAACCGCTGCACCGGTGGACTAGACGCT CGCTCACGTTCGGGAAGAATTTTATAATATAAGTGACACCCCTAATTTTT TCCTTCTTTTCTAGTCAGGGTGTATATCTTCTGAAACGTTTTGATTCCCC ATCAAATTATCAGTTTATCTTACGACAATCTTGGATTTTTCAAAAACTAT CAAGATTATACGGGACTAATCCTGCCTCTCTTTCCCACTGCGACTCCTGT ACAGCCAGGATCTACAGCTTGCCCTCGAACAAACCCAACCAAAACCAAAT TATCAAAATTGTGTATCTTTTTTCCTAATGTGCAATTTTTCGATTGTTTC AGAGTCAACTGTGGGACGAGTTTGAGCTAGAGGACGCCACCTTCGCCGAG TGCAGCATCAATAACGCCAACAACAGCTTCCAAGTAAATTCATATGACTC GTATAATAGACTAGCAGTGCCCGCGACTTCGTACGCCTGAAAATCATTTT TGCTCTGCACCTATTACTTGTAGCGTGATAGTATATAGCCTATAGCCTTC CTCGATAAATGGGCTATCTAACACTGAAAGAATTTTTCAAATCGGACCGG TATTTCCTGAGATTAGCGCGTTCAAGTAAACAAACAAACAAACTCTTCAG CTTTATAATATTAGTATAGATATTCAAAAACTGACAAGTTTAACACCCGT ATTCGCAAACGATGCTTGCAGTGAAGCACCAACACTATGCGAAATCGAAC GCACAGCGATAAACATAAACAATTCTATGAATTGGTTTTTGGGACCCTGT GCGTCCACCCGCACTAATAGTATTGTTTGTGAATGCAAGTGTTTGACAGC AGGAGGTCAATCTATCGACCCTACAGCAGTCTGAAATAGAAAATAAGCTT AAAAAAGAGAACCATGAAGGTGTTACGTTCCTACTCTTACATACGTAGAC TATTACGTTAGTATTAATTAGTCAATGAGAAAATGAAAATGAACCTCATA GTAAAACTTCTAAAATTAAATACGCTCTTTTCTAAGTAGCGTTGTAATCA GAAGTGAAACATGAATGAATAAGCCCTTGCTTACCCGACAGAAAGTTATT TCATTGTAAACGTTCCAAGAATCGACCGGGTTAATTCTAGGTTTTAGTTT GCTGTTAAATTAGTAGCGCTATGAATAATAACAAATGCGAATATCTATTA ATGCTTTGTTTTGGAATTTAGTTCAGTAGTTATGGCACAAAATGAGTGCG TATTTCTTGAAAAAGGTGCCTAGGTGGGGTAATTTCACTAAAACCAGTAT ATTTTCTGATTAATTTTCTTCAGATTCTTTTCGTTATGGTTTCGAGAAAC GATTTTTTTTAAACACAGCCTAATTAGACCAATTTATTATACTGGTGGTT TTACGAAAATGCAGTAGAATGGAGGTGATGATTGTCCAGTTTTTGGTGTC AGAATCTCTTTGACTCGGGTCAAAAGTGCGGACTGACGAATGCCAACGCG CAATGTATTCTATTACACATGCTTTTGTTGCATTCCACGTGACGCTTTGT GACGTTTGTCTACACAAATTCGCGAAACAAAGGAAGCTTGAAACATGGAA ATGGACGCGACAAAATTCACGGTGGAATGTGTTTATTTGACTTGTTTTTT GGTAGGTGCAACTGTTTTTACAGCTGGAACAAAAGTAGCGTGTGACGTAA AAGTTTAGAAAGCATGTAGAGCGCTACTATTAATATTTCAGTTAGCCTGG GCGCAGACAACCGACTTTTAGCTGGTCTATAGTTGATTCGGGCTGTTAAT CAGTATGGAGTTGTATGAAAGTGCGCACATTGGATCGGCCAATTCTTCAT ACAAATTAGAATCGGGCCCAACTATCGCCAGACTAAAAGTTAGTTGTCTG TGCCCAGGCTTACTTGACATATACGTAATATTAAAGCATTATTTTACTTT AATTTATTGCCCATTTATTTTAGGTTTATCATGAATTTAAACGTTTTCAA AATTATAAACGCTAGTATATACGTGATTACATAATTTATTGTACCTGGTC TATGTAATTCTGTATAAGCATAATACATAATTTAGTGGAGCTCATACAGA ATTACATAAACCGTTTCCACTGATGAGTATCTATGGATTAGACAGGCTTA AGATTAAAGCTAATTTACAAAATAAATTATCCACTCATTAAATCATTACT CATAAGGTTTTAAGCTGTATTCACGACTTATAACAGAGTAGAAAATCTCA TTTTCATCATAATCTTTATTTGATTTTACTAGCATTTCTTTTTCAAGCTT AATTTTGTCTACTCCGCAAAAAAAAAATACGCCAAGACTTAACANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCAAACTAAGCA AAGCTTGTACTATGGGTACTAGACAACGGATATAAACATACTTAAATACT TTTTTTTGTAAATACATACTTATTAACCATAGAAAACACCCAGTCCAATA CAAACAAATATGTTCATGCACACAAATGTTTGTACTGTGCGCTTCCGCTT GGAATAGTAGTCCGTTTCGAACCACTATTGCACTACACCAAACGGCCGGC GTCACAAACTATTTGACACTTACGCTGTGTTGCACCACCTAACTTTGACC GTAACTATGACGATAACCGGTGCTTTTTGTATGGAGTTTGACAGATTTTT TTGACGTTTGTCAAAGTTAAAGTAAGATGGTGCAACCCAGCCTAACTGTA CGARTTACCGCCGCACTTAATGGTCCACTCCACGAGTGTACAAGAAAGGC TGCAATGCGGGAGGAATGGTCGCCATTGTGAAGCTTGCCACCAAACCAGG TGTGTGACGACCACGACCACTCTGCCAAGAGTGTAGCGATGAAGAAGAGA AGTACGAGTTACTCGTTCCTTACTTGTTATATTACAGCGACTATCATTAA ATCAAGGCTTTGTTACATTAACTAGTTAAATGGACCGAGATGAACGAGGC AGCGTCCAGTGTCTGCTAACCCTTAACTTTCTCAACGAAGCGCACGCCTG CAAAAACACATTTATTAGTGAGACGCTGTCATAGCGATAGATACAGCAAA AGATAAATTGATAGCTATGTATTTAATTTCGTCTGAACTGAATATATGTT TATGGTTCAAATTATGTTTTATTTTAACGGTAACTATGACGATAACCGGT GCTTTTTATATGGAGTTTGACAGATTTTTGACGTTTGTCAAAGTTAAAGT AAAATACAAGCCAGTCTAAGTGAACACGTGAATAAGTTCTATGACTTATC TACCTTCCTTTTAGATTACCGTATTCAATAAACCAACTGATCGCAAAATA GTATAATGTATAACCATCCCAATTCGCTAAGCGTATTATAATGTAGCCCT AGTTACCTTTCTAAATGGAATTCAGGTGCTAGAGCGGCGGTAAAACGCGG GGATTGAATAATATAAAGCAGGTCAAATGGAAACCTGTTTTCATTCATTC TTTCATCGCATTACATGCAAATAATGCCTTAATGGAGCACTCAGTGCCTG CATTGGAAAACACTCGATTGAATCTTTTGTATTGTAAGCCAGAAATGAAA AAGTTTATTGAAGTCTCTATTGCTCATGAGTTTATGAAAGACTACACAGC GAAGAACTTTGCTTGTTACCTTGTTACATGCATAGCGTAGGGTATAAGGT ATTATTATGGTTTAAGTGTGCTTAAGCTAAAGGGTTAAGTTCTTGTTTTC AATGGTCCTGATCCACCAACAATTTTGTTAATTAAAAACCAAAAGTCTGT GTATAATAACACCAAGCCATAGTAACAACAATCAGTATTCTTTGACTACC TAGAGCATAAAGTCTTATTCGTACCTTAGTTACATTATAAAGAGTATTTT TCATTAATTAAAGAAGCCACGATAGCCGAACGGTGAAGGGTCGGACTGGC CGACTCGAGATCCGAGAAACGCGGGTTCCAATCCCACCGCGTCGCTCGAC TCTTGTGGTGAGCCCACTCGTAACACAAGTGCAATACAAATCTATACTTA TAATAAATCTGTAGAGAGGTCAATTCTGTACATTAAATATATTTTCAAAA TAACTATCAGGGGGTAATTAGTGATCGATACTGATGCCAAAAAATGCAAT CAGTAATATTTTTGTCTGTCTGTCTGTCTGTCTGTATGTTCCTTATAGAA ACAAAAAGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGA AAAAACATTTGTATGAAAAAATCTAAACCGCGTAAGTTAGATGAAGGGGG TAAAACGGGATCCACGCGTACGAAGTCGCGGGCGGCCGCTAGTTACTAAT AATCTTTAAAAAATAGTAGTAAGTGAAACAAAAACATATCGAAATCTGCT CGCTGAACAGAAGCTGCGTTATAAATATTTATAAACCCGACAAAAGCCAT TGGATATTCCCATCCTCGCGGAATAATCAAATTAAATATATATAGGCTTT GCGTTTGAGTTTATCTACCCCACGCGTCACAGCTTTATGGGATCAGCCTG CTCAGACTGCCAACTCGGATACTTGGTTAATAGTTTTACATTCGGATGGA CTAAGGCCGGCAATACACGGACCGCTTGAAGCAGTAAGGTCAACAGCTTC AAGCTGCGACTGCACAGTGAACTGCAGAGTTCTATGGACGCACATACACG AACCGCTCGAGCAGTTAAAACTGATTCGGGCGGTCGACAGYACGGTGAAT TTTCATCGTGCGGTCAAGCAGTCGCTAGCCATACACTGACTGCTCGAGCT GTCGTCAGTGCTCAAAACCATGGTGCTACTGATTTGAAATTGCCCACCGC TCGAACTGTTGAACCAACTGCTCGAGCAGTTACCACTGGCAGCTTCAAGC TGTTGACTCTTGACTACAAGAGTGGTCCGTATATGTTGATCACTGACTAA CTGCTCGAGCTGTCCGTGTATGGCGGGCCTAAACCACTATAAAATAGATA GACACGGGTCTTAAAGCGACATTTATGAATGAGTTACTTTATGTACTCAC AGCTTGACGTTTCGGCTGCTATGTTGCAGCCGTGGTCACAAGCAGACTGA CCGTGAGTACATAATGTAACTCGGTCATAAATGTCGCGTTAAGACTTGTG TCTTTCTATTTTAGTTGAGGAACGCGAAAGTTTAAAATCTTATAAACCTT CACAATGACATAGGAATCTAACGTTTTTCAGAAAAACTTATCAAGAGCAA CTGAATGGGTAAACAGTAGTAGTAGGACGTCATTTGGCTAAAACGAACGA ACAAAACAATATTTCTATGTTCACACGGTTTGCTGGCTGTTCTCTTTTCT CTATCGGCGTAGCTAGAGCACTGAATTGTTTTAGCTTCCATAAAATCCAC TGTTAATGCAAAACCGTACCCAATTAAGGCTGGAGTGGATGTCGCAATGG CGTGGATCGAATTTGTGAGGCTTTTTCGTCCCATTATGTCGACGTCGCGT CGCTAAGCGACACAAGAGGATCGAGCCCGCGAAATATTTTAATTTTGTTG TTGAAACTCGTTTATAATTAAGGTAAAAAAAGCTAAATCAAATCTATTTG TGATGGCTGCGATGATACAATTTTCATTAATCTAATGTAAAAAATATTTT GTATTTTTTTAAGCATAACAATCTACGCAGGGATTTTCTAAATTGTGCCG TTTCCATTTGTATTTCTTTTACAGTACAGTTTTTTAAAGAGTGCAGAAAA TAATAAGTATCTTCCTAGTATTATTTTAAATGGCCTCAACGGCGCGTATT TTACTGTCATTTATCAATGAATTTAATACTTTGACCAAGTCTGTTAATTT TCTTGCAAAATAAAAAAAAACTAAGCCACCAAGTTTGTAGTGGCAAATAT TAATCTGCCTCGGATGTCATCGCTCAGCAACCTACCTAAGCTCCATTAAG GCAAGCTGTCTCAGCGCCGAGGCGATTAGTCGGGACTCTATGGCCGCCGG AAGCTGCAACGATAAGCTCCGCAACTTTTGAGCGGCGGCAAACGATATCC GGTTTGCCGAGCTTGCGAGTTGATGTTGATGGTTGCTAAAGAACCTGGGA AGAATTTTTCCATTAGTCTTAAACATTTTGAATCTTTGAGATTACTCGAG TATCTGTAAGTTTTATTGATTTTTTTTTTTAATAAAATCCGGCTTTGTCT AATCTGCGATAAGTCAGGGACCTACCAAAATAGCCCAAGAGAACAATAAC TCTCGATTTTTTCAAGAACGTCATCGGTTTCTTCCAACATTAACGTTATT TTGTCTGTTCAATACATTTATTTACCTGTATTTTGTTTGTTTGATAGATT ATTGTCGAGGTTAACGATGCTAGGAAAATATACAGGGTGAAGTATGGGAC TTTACTAGAATATACAGGGCGAAAGTATGAGACTACCCTGTATATTCTCC TGGCATCGTTAACCTCGTCCTGTCTCACCGGCACATTCTGCCGCAGGTCA TGA
back to top

Coding sequence (CDS) from alignment at newscf_2005:59832..84034-

>OSCA002369-RA ID=OSCA002369-RA|Name=OSCA002369-RA|organism=Ostrinia scapulalis|type=CDS|length=567bp|location=Sequence derived from alignment at newscf_2005:59832..84034- (Ostrinia scapulalis)
ATGGTTGGCAGTCCACAACAGTGCGTTACTCTAGAAACTTCCTGCACCGT
ACAACCAAACTGTAGAATGGACTGTCGTCTGCGGTGTTTCCGGACCGATA
CGACCTGCAAGCTTTCAAGAAGAGAGCGTATCTTCACCTTAAAGGCCGGC
AACGCACCTGTAACGCCCCTGGGACTGCGGGTCGGGCACGTACGGCCCTT
CGGCGTGGAATTCGGCGTCCAATACAAATACTTCTGGCTTCACCGCCGGC
TAGTGGAGCTAGAAATAGAAGCTGATAAAGGTAGCAGGAAGGCGCGGGAT
GCAGGCCGCTATCAACCGTGCGATGTGGATAGTCAACTGTGGGACGAGTT
TGAGCTAGAGGACGCCACCTTCGCCGAGTGCAGCATCAATAACGCCAACA
ACAGCTTCCAAATTATTGTCGAGGTTAACGATGCTAGGAAAATATACAGG
GTGAAGTATGGGACTTTACTAGAATATACAGGGCGAAAGTATGAGACTAC
CCTGTATATTCTCCTGGCATCGTTAACCTCGTCCTGTCTCACCGGCACAT
TCTGCCGCAGGTCATGA
back to top
Synonyms
The feature 'OSCA002369-RA' has the following synonyms
Synonym
snap-newscf_2005-processed-gene-0.27-mRNA-1