OSCA002747-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA002747-RA
Unique NameOSCA002747-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length559
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1859contignewscf_1859:45928..52189 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.23
QI4|0|0|0.66|1|0.66|3|0|185
AED0.23
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA002747OSCA002747Ostrinia scapulalisgenenewscf_1859 45928..52189 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002747-RAOSCA002747-PAOstrinia scapulalispolypeptidenewscf_1859 45928..52185 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002747-RA:cdsOSCA002747-RA:cdsOstrinia scapulalisCDSnewscf_1859 45928..46083 -


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002747-RA:five_prime_utrOSCA002747-RA:five_prime_utrOstrinia scapulalisfive_prime_UTRnewscf_1859 52186..52189 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002747-RA:exon:2523OSCA002747-RA:exon:2523Ostrinia scapulalisexonnewscf_1859 45928..46083 -
OSCA002747-RA:exon:2524OSCA002747-RA:exon:2524Ostrinia scapulalisexonnewscf_1859 46117..46276 -
OSCA002747-RA:exon:2525OSCA002747-RA:exon:2525Ostrinia scapulalisexonnewscf_1859 51947..52189 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA002747-RA ID=OSCA002747-RA|Name=OSCA002747-RA|organism=Ostrinia scapulalis|type=mRNA|length=559bp
AANAATGCCCGCCTACGACAACGAAGGCGCGACTATATCACTTGAAGATG
TTCGCGCAGACCCTCCCACTTCCATTCAGGAGTTGCGTGAGAGGAGGAAA
GAATTCAAAACTCAGAGGTCCACAGTCGCTTCTAGAAGAGAGCAAGCAGT
ATGTGTGAGAGGCGCCTTCAAGAAGTATGGGTCTTCGAAGAACCCTAATG
TTATATTGGATGGGCTTAATATGACAGTGCCTAAAGGAGCCATATACGGG
CTCCTAGGTGCATCAGGATGCGGGAAGACCACACTGCTGTCCTGCATAGT
GGGCAGACGGAGGCTGAATGCTGGAGACATCTGGGTACTGGGAGGCAGGC
CTGGAAGCCCGGGCAGCGGCGTCCCAGGGCCCAGGATCGGGTATATGCCT
CAAGTTAAGGAAATGCTTTGCGCATACCCACTGGTCGATGGGGACAGCCA
GTGGGTTATGTGGGACTCTCCCCGCCTGCTCACTAAAGGCGGGGCCTACC
CACTAAAACCCGACGGTGTCCACCGGAGCCCAAAGAATTGGAGCCGCGAG
TTATTGTCC
back to top

spliced messenger RNA

>OSCA002747-RA ID=OSCA002747-RA|Name=OSCA002747-RA|organism=Ostrinia scapulalis|type=mRNA|length=559bp|location=Sequence derived from alignment at newscf_1859:45928..52189- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
AAWAATGCCCGCCTACGACAACGAAGGCGCGACTATATCACTTGAAGATG
TTCGCGCAGACCCTCCCACTTCCATTCAGGAGTTGCGTGAGAGGAGGAAA
GAATTCAAAACTCAGAGGTCCACAGTCGCTTCTAGAAGAGAGCAAGCAGT
ATGTGTGAGAGGCGCCTTCAAGAAGTATGGGTCTTCGAAGAACCCTAATG
TTATATTGGATGGGCTTAATATGACAGTGCCTAAAGGAGCCATATACGGG
CTCCTAGGTGCATCAGGATGCGGGAAGACCACACTGCTGTCCTGCATAGT
GGGCAGACGGAGGCTGAATGCTGGAGACATCTGGGTACTGGGAGGCAGGC
CTGGAAGCCCGGGCAGCGGCGTCCCAGGGCCCAGGATCGGGTATATGCCT
CAAGTTAAGGAAATGCTTTGCGCATACCCACTGGTCGATGGGGACAGCCA
GTGGGTTATGTGGGACTCTCCCCGCCTGCTCACTAAAGGCGGGGCCTACC
CACTAAAACCCGACGGTGTCCACCGGAGCCCAAAGAATTGGAGCCGCGAG
TTATTGTCC
back to top

protein sequence of OSCA002747-RA

>OSCA002747-PA ID=OSCA002747-PA|Name=OSCA002747-RA|organism=Ostrinia scapulalis|type=polypeptide|length=185bp
MPAYDNEGATISLEDVRADPPTSIQELRERRKEFKTQRSTVASRREQAVC
VRGAFKKYGSSKNPNVILDGLNMTVPKGAIYGLLGASGCGKTTLLSCIVG
RRRLNAGDIWVLGGRPGSPGSGVPGPRIGYMPQVKEMLCAYPLVDGDSQW
VMWDSPRLLTKGGAYPLKPDGVHRSPKNWSRELLS
back to top

mRNA from alignment at newscf_1859:45928..52189-

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA002747-RA ID=OSCA002747-RA|Name=OSCA002747-RA|organism=Ostrinia scapulalis|type=mRNA|length=6262bp|location=Sequence derived from alignment at newscf_1859:45928..52189- (Ostrinia scapulalis)
AAWAATGCCCGCCTACGACAACGAAGGCGCGACTATATCACTTGAAGATG TTCGCGCAGACCCTCCCACTTCCATTCAGGAGTTGCGTGAGAGGAGGAAA GAATTCAAAACTCAGAGGTCCACAGTCGCTTCTAGAAGAGAGCAAGCAGT ATGTGTGAGAGGCGCCTTCAAGAAGTATGGGTCTTCGAAGAACCCTAATG TTATATTGGATGGGCTTAATATGACAGTGCCTAAAGGAGCCATGTAAGTA CAAATAGACTAAGAGCTTGTGAACGCCAGACCCAGGTCATTTTATAAAAG CCGAAAGTTTGTCAGCGCACACTCCCAAAATAGACTAAGAACTTTGGTGC AACATGAAGTTTGGGTCATTGTGGCTTTGGCAGCTACCTAAAAATTAAAT GATTGGAACGGTCAAAACTATCTGGCAAAACGCTTTAAAACCTTTAACAC TCGTATACGACAATTATTACTTTTTGTTAGCCAAAAAGAGGACAGAGAAG TGCCACTCTCTAACCAAAGTTGTGGAAGAATTATTATTTTAACTAGGGTA CCGTGATAAACCATAATTTTACCACTTTGGCAATAGGATACAGATAAAAT TAAAACAAACGACTGTCGCAAACGTTTTTCGCGCGTAATTTTCTTGCAAG CGTCGACAGAAACGCATCGCGCGCTCCGTGAGCTCGGGCGAAAACAAATG ACGATCGCGAAATGAAAACAAAACAATCTCGGCAGAAACCAAACACTATC GCGATTCCCTCGGGCAGCGGCGCGGTTAAAAGATTCCGCGCGCGAATGAA AACATTTTGTGACAACACGATGCAATTTGGGGTAATGTTTACTTTTAATA ATCCATTTTCAATAGTTTATTTTAGGCAATAATCAATCAGTATGAAAAAT TTCGCCCACGAAATAAAATTCTCATAGGTATTATAAGAGTAGGCAGATCT ATTAACGATTGAGTATTGACACCAAAAAATAAATACACATTTTATTTGTT ATTTATCCTTAAATCCATAGCTAAAGAACCCATTAACATTCCTAAGACAA GATTAAACAAGCAAGAATCATGTAATTGCTAAATGGGGCGGAATCTTCAG GGAAAACTTTTGTATTGAATGGTATCTTCGAATATTTTTCAAGATTAAAA AGATTACGATAACGATCATACCGTGTTTTAGATTAGGGCTGAGTTTATTG AAATTTTTTGCAAAGTTTTATAATGTATTTAATTTATTAACGAAATATTT TTACTTCATAAAAGTAATAAAAATTATTAAAAAGGTTTTATTGCGAATAT CCACGCCTTTTTACGCCTCACTTTTAGATTTAAAAATGAAATAGGTTTTA ATCCAGTTGCGTTAACACTGGCCGCAAAATTGGTAATTTTAAAGAAAAAA AATGTAGAGAAAAATAAACAAACAATTAATATCGCGCCTGATCATTGTTT GCAAAATGGATGGTTATACAATTAAATATTAATTTAGTTGAAAAATGGAC GCAATACTAAAATTTGTCGAAGAAATGATTACTTTTTAATCAGGTAAGTG AATAACACATTGGCTGGTTACATTCGAAAATTTCGTTTGGAAATGAACTG CAATTTACATTCGTAAACGAAACAACATTGCAATAAAGTTAATAAACTTG AATTCATTTTCCTTTTGGATTTAATTTTAAAGTAATTGCAAGTCGGATGG ATTCATTTACGACACAATCAGAAGAATTTATTTGTAGGTAATGAAGAATT AAAAGTTCGAATACTTAAACCTCGTACATGGGGTTGGACAGTAAAATTTA AAGTTTAAAGCTTAAAAAGCTTACGATTTTAATCCGGAGGCGAACGTTGA ATGTTTGTGTGATGCATCACGAGAGATCGTAGATTCTGCCCTGTTACTAC TTACTTTTTCTGGCCCATTCCCATTTTATTTGGGGTCGGCCCTCCGTATC ATGCGTTTCCAGGCGGCTCGGTCCTGGGTCGTCTCACTTTTGACTTGGGC CTCTTTAAGGTCCTTATTTACTACGGACTTCCATGTGATTCGGGGTCTTC CTCATCCTTGGGGCTTAGTTTGGATGTCTAGTACTTTTCTGGTCATATGG TCGGGTGGTCGCCTCATAACGTGTCCGTCACCGCAGACGGCTCTCCTGCA GTTTAGCTGGGATAGGTCTCAATTTGAAGGTGCCTCTTATGTGTGTGTTT CTTACATGGTCCAGTCTAGTTACACCACTTGCCCATCTGAGCGATTGAAT TAAGTTTATTTAATGAATAAAGCATCATTCTATAATTATGAAACTAAAAG GTCCTTTATTAGTCTAACAGACTGCCCATAATAAACCTTTAATATTTCCG CAGATACGGGCTCCTAGGTGCATCAGGATGCGGGAAGACCACACTGCTGT CCTGCATAGTGGGCAGACGGAGGCTGAATGCNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATG AAAAATTTCGCCCACGAAATAAAATTCTCATAGGTATTATAAGAGTAGGC AGATCTATTAACGATTGAGTATTGACACCAAAAAATAAATATACATTTTA TTTGTTATTTATCCAAAGAACCCATTAACATTCCTAAGACAAGATTAACA AGCAAGAATCTTGTAATCGCTAAATGGGGCGGAATCTTCAGGGAAAACTT TTGTATTGAATGGTATCGTCGAATATTTTTCAAGATTAAAAAGATTACGA TAACGATCATACCGTGTTTTAGATTAGGGTTGAGTTTATTGGATTTTTTT GCAAAGTTTTACAATGTAGGTATTTAATTTACGAAATATTTTTACTTCAT CAAAGTAATAAAATTTATTCAAAGAGGTTTTATTGAAAATATCCACGCCT TTTTACGCCTCACTTTTAGATTTAAAAATGAAATAGGTTTTAATCTTGTT TTAATCCAGTTTCGTTAACACTGGCCGCAAAATTGGTAAGTAATTTTAAA GAAAAAAAATGTAGAGAAAAATAAACAAACGAATATCGCACCTGATCGTT GTTTGCAGAATGAATGGTTATTCAATTAAATATTAATTTAGTTGAAAAAT GGACGCAATACTAAAATTTGTCGAAGAAATGATTATTTTTTAATCAGGTA AGTGAATAACACATTGCCTGGTTACATTCGAAAATTTCGTTTAAATAAAT AAATAAATATTTATTTAAACGAAATGAACTGTAATTTACATTCGTAAACG AAACAACATTGCAATAAAGTTAATAAACTTGAATTCGTTTTCCTTTTGGA TTTAATTTTAAAGTAATTGCAAGTCAGATGGATTCATTTACGATACAATC AGACGAGTTTATCTGTAATTAAGAATTAATAGTTCGAATAAACCTCGTAC ATGGGGTTGGTCAGGAAAATTTAAGTTTTAAGTTTAAAAAACTTTTTGAA TTCGGAGGCGAACGTTGAATGTTAGTGTGATGCATCACGAGTGATGGTAA ATTCTGCCCTGTTACTACTCACATACTTTTCCTGACCCATTCCCATTTTA TTTGGGGTCGGCCCTCCGTATCCTGCGTCTCCAGGCGGCTCGGTCCTGGG TCGTCTCACTTTTGACTTGGGCCTCTTTAAGGTCCTTATTTACTACGGAC ATCCATGTGATTCGGGGTCTTCCTTATCCTCGGGGCTTAGTTTGGATGTC TAGTACTTTTCTGGTCATATGGTCGGGTTGTCGCCTCATGACGTGTTCGT ACCACTGCAGACGGCTCTCCTGCAGTTTAGCTGGGATAGGTCTTACTTTG AAGGTGCCTCTTATGTGTGTGTTTCTTACATGGTCCAGCCTAGTTACACC ACCTGCCCATCTGAGCGATTGAATTAAGTTTATTTAAGAACTAGCTTTTA CCCGCGGCTTTACCCGCGTGAAATTTAGTGCCACAGATTGGCATAAACTA TATTATTATAGCCTATATGTTAATCTGGGTTACAAATAATAATACTGTAA AGTTTCAACCAAATCCGTTCAGTAGTTTTTGCGAGAAAGAGTAACAAACA TCCACACAAACTTTCGCCTTTATAACATTAGTAGGATAGTTCTATGTCTT TCTTTCAAATAAAAACTATTATATTCTAGACTATTCTATAATTATGTAAC TAAAAGGTTCTTTATTAGTCTAACTAACAGACTACCCTTAAGAACACTTT AATATTTCCGCAGATACGGGCTCCTAGGTGCATCAGGATGCGGGAAGACC ACACTGCTGTCCTGCATAGTGGGCAGACGGAGGCTGAATGCTGGAGACAT CTGGGTACTGGGAGGCAGGCCTGGAAGCCCGGGCAGCGGCGTCCCAGGGC CCAGGATCGGGTATATGCCTCAAGTAAGTATTAATAGGCCAAAACTTTTT TTTAAGGTTAAGGAAATGCTTTGCGCATACCCACTGGTCGATGGGGACAG CCAGTGGGTTATGTGGGACTCTCCCCGCCTGCTCACTAAAGGCGGGGCCT ACCCACTAAAACCCGACGGTGTCCACCGGAGCCCAAAGAATTGGAGCCGC GAGTTATTGTCC
back to top

Coding sequence (CDS) from alignment at newscf_1859:45928..52189-

>OSCA002747-RA ID=OSCA002747-RA|Name=OSCA002747-RA|organism=Ostrinia scapulalis|type=CDS|length=555bp|location=Sequence derived from alignment at newscf_1859:45928..52189- (Ostrinia scapulalis)
ATGCCCGCCTACGACAACGAAGGCGCGACTATATCACTTGAAGATGTTCG
CGCAGACCCTCCCACTTCCATTCAGGAGTTGCGTGAGAGGAGGAAAGAAT
TCAAAACTCAGAGGTCCACAGTCGCTTCTAGAAGAGAGCAAGCAGTATGT
GTGAGAGGCGCCTTCAAGAAGTATGGGTCTTCGAAGAACCCTAATGTTAT
ATTGGATGGGCTTAATATGACAGTGCCTAAAGGAGCCATATACGGGCTCC
TAGGTGCATCAGGATGCGGGAAGACCACACTGCTGTCCTGCATAGTGGGC
AGACGGAGGCTGAATGCTGGAGACATCTGGGTACTGGGAGGCAGGCCTGG
AAGCCCGGGCAGCGGCGTCCCAGGGCCCAGGATCGGGTATATGCCTCAAG
TTAAGGAAATGCTTTGCGCATACCCACTGGTCGATGGGGACAGCCAGTGG
GTTATGTGGGACTCTCCCCGCCTGCTCACTAAAGGCGGGGCCTACCCACT
AAAACCCGACGGTGTCCACCGGAGCCCAAAGAATTGGAGCCGCGAGTTAT
TGTCC
back to top
Synonyms
The feature 'OSCA002747-RA' has the following synonyms
Synonym
maker-newscf_1859-snap-gene-0.30-mRNA-1