OSCA002752-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA002752-RA
Unique NameOSCA002752-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length282
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1859contignewscf_1859:73335..73822 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.68
QI0|0|0|0.5|0|0|2|0|93
AED0.68
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA002752OSCA002752Ostrinia scapulalisgenenewscf_1859 73335..73822 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002752-RAOSCA002752-PAOstrinia scapulalispolypeptidenewscf_1859 73335..73822 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002752-RA:exon:2549OSCA002752-RA:exon:2549Ostrinia scapulalisexonnewscf_1859 73335..73447 +
OSCA002752-RA:exon:2550OSCA002752-RA:exon:2550Ostrinia scapulalisexonnewscf_1859 73654..73822 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA002752-RA:cdsOSCA002752-RA:cdsOstrinia scapulalisCDSnewscf_1859 73654..73822 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA002752-RA ID=OSCA002752-RA|Name=OSCA002752-RA|organism=Ostrinia scapulalis|type=mRNA|length=282bp
ATGGGTCGCGACCCATTGGTGGGTCACGAGCGAACATTGAGTGGGCCCTG
CCTGTATAACGACACACCACCCTACTCATCCAACCGCTGGGCAGCAGGTG
AAATTTCCTATAGGTCTTATCAAAAGTGTAAAATAATTACCAAACGAATA
TTCAAAGCCACCAAAGCCAAAAGTCCACCCACAAGGTTGACCGACGACCT
CATAAAGGTAGCAGAAAGGCGCTGGATGCAGGCTTCCAACCGGGCGATGT
GTAAATCATTGGAGGAGGCCTATGTTCAGTAG
back to top

spliced messenger RNA

>OSCA002752-RA ID=OSCA002752-RA|Name=OSCA002752-RA|organism=Ostrinia scapulalis|type=mRNA|length=282bp|location=Sequence derived from alignment at newscf_1859:73335..73822+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGGTCGCGACCCATTGGTGGGTCACGAGCGAACATTGAGTGGGCCCTG
CCTGTATAACGACACACCACCCTACTCATCCAACCGCTGGGCAGCAGGTG
AAATTTCCTATAGGTCTTATCAAAAGTGTAAAATAATTACCAAACGAATA
TTCAAAGCCACCAAAGCCAAAAGTCCACCCACAAGGTTGACCGACGACCT
CATAAAGGTAGCAGAAAGGCGCTGGATGCAGGCTTCCAACCGGGCGATGT
GTAAATCATTGGAGGAGGCCTATGTTCAGTAG
back to top

protein sequence of OSCA002752-RA

>OSCA002752-PA ID=OSCA002752-PA|Name=OSCA002752-RA|organism=Ostrinia scapulalis|type=polypeptide|length=93bp
MGRDPLVGHERTLSGPCLYNDTPPYSSNRWAAGEISYRSYQKCKIITKRI
FKATKAKSPPTRLTDDLIKVAERRWMQASNRAMCKSLEEAYVQ
back to top

mRNA from alignment at newscf_1859:73335..73822+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA002752-RA ID=OSCA002752-RA|Name=OSCA002752-RA|organism=Ostrinia scapulalis|type=mRNA|length=488bp|location=Sequence derived from alignment at newscf_1859:73335..73822+ (Ostrinia scapulalis)
ATGGGTCGCGACCCATTGGTGGGTCACGAGCGAACATTGAGTGGGCCCTG CCTGTATAACGACACACCACCCTACTCATCCAACCGCTGGGCAGCAGGTG AAATTTCCTATAGGTGGGTCCCGAATTTGGGAACTTGTATTAGATGAGTC GTAGCTCAGACAACTTTGGGAACCACTGGTCTAGATATATTCTGACCTCG GCTTTCTTAGTTAATTTTTTTCTGTCAGAGAAAGCTACACGATTAAAACA CAGTCGCAAAAGCTAAGATTAATATACGAGTGATCTAATTAAAATCAAAA TCTCATTAAAACTAATCAGGTCTTATCAAAAGTGTAAAATAATTACCAAA CGAATATTCAAAGCCACCAAAGCCAAAAGTCCACCCACAAGGTTGACCGA CGACCTCATAAAGGTAGCAGAAAGGCGCTGGATGCAGGCTTCCAACCGGG CGATGTGTAAATCATTGGAGGAGGCCTATGTTCAGTAG
back to top

Coding sequence (CDS) from alignment at newscf_1859:73335..73822+

>OSCA002752-RA ID=OSCA002752-RA|Name=OSCA002752-RA|organism=Ostrinia scapulalis|type=CDS|length=282bp|location=Sequence derived from alignment at newscf_1859:73335..73822+ (Ostrinia scapulalis)
ATGGGTCGCGACCCATTGGTGGGTCACGAGCGAACATTGAGTGGGCCCTG
CCTGTATAACGACACACCACCCTACTCATCCAACCGCTGGGCAGCAGGTG
AAATTTCCTATAGGTCTTATCAAAAGTGTAAAATAATTACCAAACGAATA
TTCAAAGCCACCAAAGCCAAAAGTCCACCCACAAGGTTGACCGACGACCT
CATAAAGGTAGCAGAAAGGCGCTGGATGCAGGCTTCCAACCGGGCGATGT
GTAAATCATTGGAGGAGGCCTATGTTCAGTAG
back to top
Synonyms
The feature 'OSCA002752-RA' has the following synonyms
Synonym
maker-newscf_1859-snap-gene-0.27-mRNA-1