OSCA004922-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA004922-RA
Unique NameOSCA004922-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length339
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2520contignewscf_2520:68307..81992 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED1.00
QI0|0|0|0.66|0|0.33|3|0|112
AED0.35
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA004922OSCA004922Ostrinia scapulalisgenenewscf_2520 68307..81992 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA004922-RAOSCA004922-PAOstrinia scapulalispolypeptidenewscf_2520 68307..81992 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA004922-RA:exon:1347OSCA004922-RA:exon:1347Ostrinia scapulalisexonnewscf_2520 68307..68366 +
OSCA004922-RA:exon:1348OSCA004922-RA:exon:1348Ostrinia scapulalisexonnewscf_2520 70106..70357 +
OSCA004922-RA:exon:1349OSCA004922-RA:exon:1349Ostrinia scapulalisexonnewscf_2520 81966..81992 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA004922-RA:cdsOSCA004922-RA:cdsOstrinia scapulalisCDSnewscf_2520 81966..81992 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA004922-RA ID=OSCA004922-RA|Name=OSCA004922-RA|organism=Ostrinia scapulalis|type=mRNA|length=339bp
ATGGCCACTAGGGCAGAAAAGTTCTCGAGTGGCAACCACGGGCCGGAAGA
CGTAGTGTGGCTGATGGCCGCTGGGGCAGAAAAGTTCTCGAGTGGCGACC
ACGAGCTGGAAGACGTAGTGTGGGCAGGCCGCCCACTAGGAAACATTGAA
TTTTCGGATAGATCCAATTTATTTTGTAACATATTATTGATACCGTTTGA
AAGAGCTCGTGAAACACTTTCAGGATCAGTAACGAGTTTTTCTTGTATAG
TTTCAATAATCAAGTGGGATCACTTATCGTTTCTACCCTGTATGTATTTA
TTGAAGTGTACTGTAGCGGCGAATCTCAAGATTAGATAA
back to top

spliced messenger RNA

>OSCA004922-RA ID=OSCA004922-RA|Name=OSCA004922-RA|organism=Ostrinia scapulalis|type=mRNA|length=339bp|location=Sequence derived from alignment at newscf_2520:68307..81992+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGCCACTAGGGCAGAAAAGTTCTCGAGTGGCAACCACGGGCCGGAAGA
CGTAGTGTGGCTGATGGCCGCTGGGGCAGAAAAGTTCTCGAGTGGCGACC
ACGAGCTGGAAGACGTAGTGTGGGCAGGCCGCCCACTAGGAAACATTGAA
TTTTCGGATAGATCCAATTTATTTTGTAACATATTATTGATACCGTTTGA
AAGAGCTCGTGAAACACTTTCAGGATCAGTAACGAGTTTTTCTTGTATAG
TTTCAATAATCAAGTGGGATCACTTATCGTTTCTACCCTGTATGTATTTA
TTGAAGTGTACTGTAGCGGCGAATCTCAAGATTAGATAA
back to top

protein sequence of OSCA004922-RA

>OSCA004922-PA ID=OSCA004922-PA|Name=OSCA004922-RA|organism=Ostrinia scapulalis|type=polypeptide|length=112bp
MATRAEKFSSGNHGPEDVVWLMAAGAEKFSSGDHELEDVVWAGRPLGNIE
FSDRSNLFCNILLIPFERARETLSGSVTSFSCIVSIIKWDHLSFLPCMYL
LKCTVAANLKIR
back to top

mRNA from alignment at newscf_2520:68307..81992+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA004922-RA ID=OSCA004922-RA|Name=OSCA004922-RA|organism=Ostrinia scapulalis|type=mRNA|length=13686bp|location=Sequence derived from alignment at newscf_2520:68307..81992+ (Ostrinia scapulalis)
ATGGCCACTAGGGCAGAAAAGTTCTCGAGTGGCAACCACGGGCCGGAAGA CGTAGTGTGGGTAGGCCTCCACTAGGAAACATTTCGTCCGAAACATCCGT TCGCAAAATATTAAAGTTTAAGTGCCAATTTTTGTAATAATAGTGCTTTT TATGAACTTTCAAGGAAAACTATAACGGTTAAGATAGATCAGTTAGTTTA AGAGAAATAGTAGATTAACTCATGTATTATACAATTTCATATCTCATAAA AAATCCTTAGAAAAAAATCTGAAAAGTGACTAGATGAAGTAATTGCTTGC TTCTGAAATATATTGTGGTAACGACGGACAACTACGGAACCCTACACTGA GCGTGGCATGACACACACTTGGCAAATTTTCTTGTATAGTTTCGAAATAG TCAATTGGAATCACTTATCGTTTCTACCCTGTATGTATTTATTGAAGTGT AGGTATTGTAAGATAGATTGAAACCCCGCAATATTCATTCAAACTAGAAA CCTCAAACTAATCGCTTCCTTTCAGTGTTAGAACCCAGAACCCATAGCTA CAAACCATTAAATCAAATAGAATCCCCGCCAAGCTAAAGAGGTGTTTTAA CCCTCCAATTTCTCTATGTCCGAGTTATTCACTCCAATCTAAGTTGAACA ACAATCAAAGGCAATTTACTTAACCGACCCCGCGGTGTCTAAAATGGGCT ATCAATTGATTCGGAATAGAACAATACAACTCAGCTAGGGTGGTGTAGTG AAATTAATTCTAGACCTACTTCCAATCCAATAAACACTAAAGTTACTAGA CGTGCTTTGTCATTGAAAACATATACAGGGTGACTGGAAATTAGTGGCGG AGCCGTTAAGGGGATGTAGTCTAAGTTATTCTGACATCACTATGAGACCT ACCGTCCTTATTAACGTTTTTGTTTAGCACTTTTAGCATAAAACAATGAC AGTTACGAAGATATAAAAATTAATATTACTTATTTAGAATATCTTTGTTA CAAAACAAAGTAGGCCAAAATCAGTCTTTTTAGAATTTATTACTATTGGA AAAATTTTGGTTACACTCATTAAATAGGAATATATTGGAAAGGGTTAAAT AAGGACGGTAGGTCTCATAGTGATATCTGTCAGAATAACCCTAGACTACC TCCACTTAACGGCTCCGCCACTAATTACCAGTCACCCTGTATAACTCCAA CTAATAGTTCTGTTTTACTTAGTAATTATTCGTTGAATTTAATGCTTGAA TCCATATGTGCCCTAATTTATATGTCGGTTTTCTTCTTTCTTCTTCTTCT TTCTCTGCTTTTAATTCAGTAACTATAAATGGTCTAGAAATTCATTTAAG CCCGAGGACGTCCACTGCTGGACAAAGGCCTCCTCAAAGATTTCCACAAC TGAACAGCAGTCCTGCGCTGCCCGCATCTACGAATAAGTGCTTCCCCTGT GAAGGCTTTCCTCGATCATTATTTATTATTTTCAGATAACTACCAGTTAG TGGTATTAATGTCACCCTAACTTACGTGAAATAAGGTATCATAAATACAA TTATTGCGTTATATGTTCAACTATGTAGTCAAGCAAAGAGGAGCAAAAAG AAAAGCACACAAGAAAACTACTGAAAGGATTTTGATGAAACTTTACCGTA TTGTTGTTTATACATCAGAATAACATAAGACGAATAGCTTTCGCGCTTCG CCCGCGTGGAATTTTGTCTGTCACAGAAAAACTTTATCGCGCGCGTCCCT GTTTCAAAAACCGGAATAAAAACTATCCTATGTCCTTTCNCTCGTCGAGC TGATGGCCGCTGGGGCAGAAAAGTTCTCGAGTGGCGACCACGAGCTGGAA GACGTAGTGTGGGCAGGCCGCCCACTAGGAAACATTGAATTTTCGGATAG ATCCAATTTATTTTGTAACATATTATTGATACCGTTTGAAAGAGCTCGTG AAACACTTTCAGGATCAGTAACGAGTTTTTCTTGTATAGTTTCAATAATC AAGTGGGATCACTTATCGTTTCTACCCTGTATGTATTTATTGAAGTGTAC TGTAAGATAGATTGAAACCCCGCAATATCCATTCAAACTAGAAACCTCAA ACTAATCGCTTCCTTTCAGTGTTAGGTAGCACCTAGGAATAGAACCCAGA ACCCATAGCCACAAACCATTAAATCAAATAGAATCCCTGCCAAGCTAAAG AGGTGTTTTAACCCTCCAATTTCTCTATGTCCGAGTTATTCACTCCAATC TTAGTTGAACAACAATCAAAGGCAATTTACTTAACCGGCCCCGGGGTGTC TAAAATGGGCTATCAATTGATTCGGAATAGAACAATACAACTCAGCTAGG GTGGTGTAGTGGAATTATTCTAGACCTACTTCCAATCCAATAAACACTAA AGTTATACTAGACGTGCTTTGTCATTGAAAACATATACAGGGTGACTAGA AATTAGTGGCGGAGCCGTTAAGGGGATGTAGTCTAGGTTATTCTGACAGA TATCACTATGAGACCTACCATCCTTATTAACGTTTTTGTTTAGCAGTTTT TGCATAAAACAATGACAGTTACGAAGAATATTACTTATTTAGAATATCTT TGTTACAAAACAAAACAAAACAAAGTAGGCCAAAATATTTTTTTTTTAGG ATTTATTACTATTTGAAAATTTTTGGTTTAAATAGGAATATATTGGAAAG GGTTAAATAAGGACGGTAGGTCTCATAGTGATATCTGTCAGAATAACCCT AGACTACATCCCCTTAACGGCTCCGCCACTAATTACCAGTCATCCTGTAT AACTCCAAGTAATAGTTCTGTTTTACTTAGTTATTATTCGTTGAATTTAA TGCTTGAATCCATATGTGCCTTAATTTATATGTCGGTTTTCTTCTTCTTT CATCTCTGCTTTTAATTCAGTAACTATAAATGGTCTAGAAATTCATTTAA GCCCGAGGACGTCCATTGCTAGACAAAGGCCTCAAATATTTCCACCACAC CGGTCTGCGCTGCCCGCATCAAGGTGCTTCCGCTGTGAAGGCTTTCCTCG ATCATTATTTATTATTTTCAGATAAGTACCATTTGCTGACATTAATGTCA CCCCAACTTACGTGAAATAAGGTCTCATAAATACAATTATTGCGTTATAT TGTTATGTTCAACTATGTACTCAAGCGAAGAGGAGCAAAAAGAAAAGCAC ACAAGAAAACTACTGAACGGATTTTGATCAAACGTTACCGTATTGTTGTT TATACATCAGAATAACATATTAGACGACTAGCTTTCGCGCTTCGCCCGTG TGTAATCAGAAAAACTTTATAGCGCGCGTCCCTGTTTCAAAAACCGGAAT AAAAACTATCCTATGTCCTTTCCCGAGACTCTAAACTATCTCTATGCCAA ACATCAAAATCGCTTCAGTGATTTAGGCATGAAAGCAAGACAGACAGACA GACAGAGTTACTTTCGCATTTACAATATATTAGTATAGATACATAAATAA AACATTTCCATAACTTCGTCAATATTCTAGCATTTTCCCCAAACAAGCAT GATTCCGCATAAACCTCTTTATATTATTATACCCTTCTTGGAGAATTTCC GTTACAAACATGGAGACATTTTCAATCACCCTACCCTCCATTTGCCACAA AGTAAAAATGTTGAAGGTCGGGTCTTTCCATGGTATCTAAATGTTGTCAA CGACATATTTATTTCGTTTTATTATTGAGGATCACAAAAATGCGTTTATA TCCTTTAATGTATATTTTCACGAGTAAAATGTCACTAAAATAGTGTTTAT TTAATGATAATTATGTTCAAATTTCTGTTCAAATGACATTTATATCAGCT TTCGTGTGTGCGTGACGTTCAAATCCAATAATCTACGTGCTCTGTCACGG TTAATATCACGAAATATCAAGTGAAATATCAAGTGACGCAATATATCATC TCTAGCTTTACATTATTTAGGGTAACCGGCGGGCAGGCAAATTGAATCTG GGACGCTTTAGGCGGAGCGCAAACGAGGCTTTGCGGCTTGCTCGACAGCA CGACTGTGTTCGGCAGATATTCGCCCGATTATTTGGCATGTGTGATTTTG TCGTACAACAGTTTGGYAAAGAGTTGTTCACATAAGTAGAGTACAGGAAG ATACGAGTAAGGCTGGCTTTCAAGTTGGTTAGGATTTAGAGCGCTGCTAC CGGCATACTCTCACAACTGAGCTCTCAACTCTCTGAATAAGTCTTCCAGC TTGGCCCACTTTTAACTTGGTCCACGGACCAAGGCCGGATAGATTTTTTT TATGCAGGACAAGGTAGATATTTCACCGCAATTGTTGTTGGTGTTAATCA AAATCATCAAAAGGATGCAATATATTTCTTCCGACAACTGGGCCCACTCT AAGATGGCATCTAAATCTACATATTTTTGATAGTGACAATCTACTTCGAT TTCCATGTGTTCTTAGCGATATCAGCTGTAACCCGATTTTTAGCAAAACT GAGTTTTATATTGAGTTAAGTATCTACTAGGTTAGATTTAAATCTATCCT TAAACATATGACCGCCTCAGATTAATTTGATGTGAACCCCGAGTAATTTA AGTTTCCCCAGAGCTAGTGCTTGCTGACCGAGCTTAATTGGCGGTCGCTG TTATACTGCATACACAGGATTGCAGTCGGAGTAGCAAAGCTTACTCCGAA TTACTATTTAGTTAAAACACAACACTATACTCTTGATCTACGTATACACG CGACCGACCAGCCGGGATAGGATGCGCGCCGTGATATACTTTATCGACGT CAAAATGTATGGGCAAATCGATAAAACGGCGTGAGAATAACATTGTAAAC TTTTCCCAGTCGATTTTCAAGACCACATTATTTGCATGATAAAAAAGTAC ATATACCAGCAGCTGCTCTCAAATGCATAAAACATATCCTTTTTAAAATA ACCGATGTCTGTTGGTCTAGAGGGGTTCCCAAAGTGGCTATGGAGGCCCT ATGGAGGCGCTAAGACCTTTAAAGGGGGGTAGTTAATATTAAAAAACCTG CGACCGCTGAGAGAATCAACTGTCAAACCACACATGTAATGCAAATAAAT TATTTGATTTGATTTGAATATATTCCAGACTGCCCAATACGACCAATATA ATTGGACTGAAGGGATGGGGGCGCGGCTCAAATAACTCCGGGAACCCCTA ATCTAGACCCTTTTTCCCTCAGCTAAAAATATCTTAGTAAACGAAATAAC CGCAACCCATCGCTCCACGTCAATAACAATAAGTGCCTGTCAAATTTGAC AAGCACAGACTATTAGGTTCGCGTCGAGCCTTAGCAAATGCCCTGCGCAT ACAAAGATAAGTCACCCTTGCCGCGTAAGGGCCACAACATATGTGGACGA CATCGCAGGACGGTCGAGTGTGGTGTCGTGAAAAATTACGATGTATTTCG TAAATATTACTGTAACACTATACTATATTGCGAGTATAATAAGGGTCTAA ACATACAAAAATGTACGAGGTCCTTTTTATTTCTAACTAGCGGCCGCCCG CTACTTCGTACGCGTGGAGCTCGTTTTACCCCCTTAGGGGTGGAGTTTCG TAAAATCCTTTCTTAGCGGATGCCTACGGCATAACATCTACTTGCATGCC AAATTTCAGCCCGATCCGTCCAGTGGTTCGGGCTGTGCGTTGATAGATCA CTTTGTCAGTCAGTCAGTCCTCAGTCACCTTTGAGTTAATAATATAGAAG TATATCTTGTGTACTTAAAAAGTTATTGCAATTTTAAAAGTGTGATACTC TCGCCCGTTTTCACAAACATTACTACAGGTCTTACAGTGCGCGTGAACGC ACAGGGTGACACACGACCAATCACAGAGCTCTATTAATTTAACGCTGTGC GTTCGATTTGCTGCTTCACTTAAGCGTAATTTTTGTAGTGTATTATGGCG ACAGACACTCCCATTTAGCGCCACAAAGCATATTGGATCTCCACATGAAA TTGCGCACTAAAATGTTTCCACTAGAAATTCGAAATTATTTTTATTTTCG TGCTCCGTAGAAATCATTTTGTGCTCCGTCGTGTGTTGATATCAAATTTT GTTCAGACCTTTTTTAGTGTACCTAAACCGTAGCATAATAGACGATTTAG CAATTTTGAACATTTTTCTACTTTCCCAAGGGATGTATTGTTAGATATTA AATTATTTGAAATATTTAGTTTCTTTTATCCACAAAGAACGTAACACTCG TCAAATCTAGAAGAAATACACTACATACCGGTCATGTTAATTGCGCATCT CGCTGAATGCGACTGTCCCACGCACTCACCCGCACACGGGGAGGGGTGTT CGTTCGCCCCGTCCGTACCAGAGCGTCGATGTGACGTCACGGCAGCCAGG TGTGCAGTTAATTTGACCGGGTTGTATACTCTTGAGTAAAACGTCTCAGT GTGCACAAAGCTTTACATTTCAATTTGCCGTCTTCCGCATAATAATGACA TCGTTTAAAAACAAAGCATTTTTAGAAAAATACCCCGCATCACATATTTG ACATAATATTTTTTCATTCGCAACATTGAAATGTGCTGAAAATTTCAACG GTTGAATGGCTGCGGAATTTCAAATCGAACGGTCAAAGCACAGTTAGGGT CAACAGATACTTTGACCCTTGTCAAATAAATTTCCGTCAAACTGACATAT CTAGCGTGGATTTCTTTCAGTTTGTCACATAAAGTAGAACTTTATGTACG CCCTCGATCATCCCTTGTTCAAGCATTTTTTTAAAAGGAGGGAAAAGCAT AAAATCTCTTACATAGATCAACATATAAAATTGTCTCAAGCAAATTTTAA TTTCTAGTACTAGGATATTGTTATCTCCAGTTCTCCACTAACTTCTGTCC ACGGCTTCGCCCGGGTGAAATCAAATTTGTGACAGATTCTTATAAATTAT AGCTTATACATATATCATTCTGATGTATAAACAATAATACTGTAAAGTTT TGTCAAAAACCGTTTAGTAGTTTATGCGTGAAAGAGTAACAAACATACTC CCGTACATACTTTCGCATTTATAATATTAGTAGGATTTATTCATTTTTTC TTTTCGTACCGGAAAGCGCAAAGTAGGACGTCCACCCACAAGGTGGACCG ACGACCACATAAAGGTAGCAGGAAGGCGCTAGATGCCCTGACCAACCGAC CAATGTGGAAATCATTGAGGAGGCCTATGTTCAGCAGCGGACGTCCTATG GCTAAAATGATGATGATGATGATGATGATGATGATGATGCTGATGATGAT GATGATGATGATGATGATAATGGTGATGAAGATGATGATGATGATGATAA TGGTGATTTTTTTTTGTAAGCTAAGCGTTAAAAATCGCTTTTTAGGCATG GCCATTTGAGCTGTATACACTGTGTTAGGTAAATGGGTATATGAGCCGAC ACTAGCCCATGTTAACATGGGCATATAAATGGTATGGTGAAGTCAGAAAA TTGATATCTTCATTTTAATTATTTTAATTTTCATACAAANTAGCCCATGT TAACATGGGCATATAAATGGTATGGTGAAGTCAGAAAATTGATATCTTCA TTTTAATTATTTTAATTTTCATACAAAATAAATTTAATAAAATCTGAATT TTATGAAAATTAAAATAAATAAAATGATGATATCAAATTTCTGACTTCAC CAGACCATTTATATGCCCATGTTAACATGGGCTAGTGTCGGCTCATATAC CCATTTACCTAACACCCTGTATTTTGGAAAACACGTAACGGATTCTAAAC CATAAATTCATGAAAGGAAAGAGGCAATTTTACGAACGTTTCAACGTCTG TAAAAGGCCTAAATGTAGATTTTTATATTTTAGTCCCACGTCAATGGTGC GAAGGATTTTGGCCTTTGAAATGCTAAACGTGGTAATGTTTTTATGTTTG TAAATTATGTATGTGTCGCAAATGCTAATGTATGGAATAAGTCATGGATG ATCTGGAAATTTTCCATTTCGGTTTCTGAAACGAATAGTGTGATAAAGCA TGTTTGATACTTGTCGAAATATGGGATTGATTTCATCAGGATTATTTTTT TGTATAATACGCAGAAAGGGTACCTTATTAGGTAGGTACACAAAATATAC CCTCTTTCTGCGTTTAGTACGTCTTTTATGACTTTTAACTTAAGTTTATT TGCTTCGTTACAATTGAAATACGTGTACATAATGATAGACATTATAATTG ATCATTATTATTGCTACAGATTTTATTAAGTGTAGGGAAAAGCTTTGAAA AGTGTTATTAAACTCAGAGAATAAAATACAATCGCACGTTTTGCAAGCAA ATTAAAAACCCAAATTATTTTTTTCCTGCTAATTTGGGATGCGAGGCGCG GCGTCAAATGCCGTAACGCGAAAAATGTGATTTTCTCGTAATAGAAATAT TCAACATTGTCTTAGAATTGCGAGTTGTTGTCAGCAAGTCAATTGTTAAA TCCAACACAATGGAGTCTGGACCGTCTTCATTCACTTANNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCG GTGCATGAGCTCCCGCCCAGTGGCGCAAATTGGGCGCACAAAACTCATTG GCGACAGAATGCTATTGGATTCTAAACTTCACAGCCCAATGCCGTAAACT GGCGTTCACCTAAATAAGGTTTTATAGGATGAGGGATTTTCCTCAAAAGT AACATTTTATTATTACTTGTTGCCGTTTTCTGGGTATTTTCTTTATAAGC TGGTATTTACATCATTACTGTGTATTTTGCCAGGATATACCTCTTAGCTC AAAAGTTATAGTTAGCGTTTTCTCTACAAAATTCACCAGAAAGTAATTAA AAGAAAAGCATCTTTAAAAAATTTAAAATAAATCTGAGATTTTTTTGACA TCTAATTAAAGCCGACGGGTGTAAAGCGTAATGGAATGTATCGTGTAATG TAATGAAAAAAGTATGTGCAGCATTTAGCCGTCCACACGTAGAATTCGTG TTACATTACACGGTGGATTACATTACACATTACACCCGTCTAGACCCGGT TTAAGCGTTAACAGTTGTATAATTTCAACATTCCATTTAACATAACGATC AAACAATTCCAATTTGTCAAAGTTTGTCACTATGACTTTAACGGAACCCA CATCCTTTGCTAAAGTCAAAACAGCACCTGTTTATTAATATACAAATTAC AAACACGCCAATACATTTCGCACCTGTCTCCCCAAATGNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNCGTAAACAATATTTCTATTGATTACCAGCTGCGATACAATATTTTA TAGAGACTGAAGAATGAGTAGGRCCTWTTCAATAGCGAAATCTATGCCTA CAATATTGTTCAAAATGTTTCTAAAGAATAAGAATGATATTTTAGTTAGT AAGCTACCTTCAGGCTCGTTAGAGCTGACGGCAACTTAACGAGATATATT TGCCATTGACATAATAACCTCAAATTTGTGCGAGCGTAAACAGAATTTGC TCGGAGTCCCGCAGTATTCGTACCACAAAGACATCTCCAAATCGCGTTCG CTAAATCATATTTCAAAATCTGATAAAACCTGACATAAAAAGAAATCCGT GGAAAGCCGAGCTGTCCATTCCAGTGATCTCATTACAACGCAATTTTCTT GTTTCACAGGTAGCGGCGAATCTCAAGATTAGATAA
back to top

Coding sequence (CDS) from alignment at newscf_2520:68307..81992+

>OSCA004922-RA ID=OSCA004922-RA|Name=OSCA004922-RA|organism=Ostrinia scapulalis|type=CDS|length=339bp|location=Sequence derived from alignment at newscf_2520:68307..81992+ (Ostrinia scapulalis)
ATGGCCACTAGGGCAGAAAAGTTCTCGAGTGGCAACCACGGGCCGGAAGA
CGTAGTGTGGCTGATGGCCGCTGGGGCAGAAAAGTTCTCGAGTGGCGACC
ACGAGCTGGAAGACGTAGTGTGGGCAGGCCGCCCACTAGGAAACATTGAA
TTTTCGGATAGATCCAATTTATTTTGTAACATATTATTGATACCGTTTGA
AAGAGCTCGTGAAACACTTTCAGGATCAGTAACGAGTTTTTCTTGTATAG
TTTCAATAATCAAGTGGGATCACTTATCGTTTCTACCCTGTATGTATTTA
TTGAAGTGTACTGTAGCGGCGAATCTCAAGATTAGATAA
back to top
Synonyms
The feature 'OSCA004922-RA' has the following synonyms
Synonym
maker-newscf_2520-snap-gene-0.27-mRNA-1