OSCA004970-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA004970-RA
Unique NameOSCA004970-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length528
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2004contignewscf_2004:38416..40663 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.28
QI0|0|0|1|1|0.66|3|0|176
AED0.28
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA004970OSCA004970Ostrinia scapulalisgenenewscf_2004 38416..40663 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA004970-RAOSCA004970-PAOstrinia scapulalispolypeptidenewscf_2004 38416..40663 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA004970-RA:exon:2790OSCA004970-RA:exon:2790Ostrinia scapulalisexonnewscf_2004 38416..38535 +
OSCA004970-RA:exon:2791OSCA004970-RA:exon:2791Ostrinia scapulalisexonnewscf_2004 40065..40265 +
OSCA004970-RA:exon:2792OSCA004970-RA:exon:2792Ostrinia scapulalisexonnewscf_2004 40457..40663 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA004970-RA:cdsOSCA004970-RA:cdsOstrinia scapulalisCDSnewscf_2004 40457..40663 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA004970-RA ID=OSCA004970-RA|Name=OSCA004970-RA|organism=Ostrinia scapulalis|type=mRNA|length=528bp
GTGCTAATAGGTGATTCGGGAGTCGGTAAAAGTAGTCTCCTATCTCGGTT
CACTAGAAATGAATTTAACTTAGAGTCAAAATCCACAATAGGAGTGGAAT
TTGCTACAAGAAGTATAGAGGTCGACGGCAAAACCATAAAGGCCCAGATA
TGGGACACGGCCGGCCAGGAGCGGTACCGTGCGATCACGTCGGCGTACTA
NCGCGGCGCGGTCGGTGCACTGCTCGTGTATGATATCGCGAAGCACCTGT
CCTACGAGAACGTGGAGCGATGGCTGCGCGAGCTGCGTGATCACGCCGAC
CAGAACATTCTCATCATGCTCATATGGGACACGGCCGCCCAGGAGCGGTA
CCGCGCGATTACGTCGGCGTACTATCGCGGTGCGGTCGGTGCGCTGCTCG
TGTACGATATCGCGAAGCACCTGTCCTATGAGAACGTGGAGCGATGGCTG
CGCGAGCTGCGCGATTACGCCGACCAGAACATTCTCATCATGCTCGTCGG
CAACAAGAGCGATCTCAGGCATCTCAGG
back to top

spliced messenger RNA

>OSCA004970-RA ID=OSCA004970-RA|Name=OSCA004970-RA|organism=Ostrinia scapulalis|type=mRNA|length=528bp|location=Sequence derived from alignment at newscf_2004:38416..40663+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
GTGCTAATAGGTGATTCGGGAGTCGGTAAAAGTAGTCTCCTATCTCGGTT
CACTAGAAATGAATTTAACTTAGAGTCAAAATCCACAATAGGAGTGGAAT
TTGCTACAAGAAGTATAGAGGTCGACGGCAAAACCATAAAGGCCCAGATA
TGGGACACGGCCGGCCAGGAGCGGTACCGTGCGATCACGTCGGCGTACTA
YCGCGGCGCGGTCGGTGCACTGCTCGTGTATGATATCGCGAAGCACCTGT
CCTACGAGAACGTGGAGCGATGGCTGCGCGAGCTGCGTGATCACGCCGAC
CAGAACATTCTCATCATGCTCATATGGGACACGGCCGCCCAGGAGCGGTA
CCGCGCGATTACGTCGGCGTACTATCGCGGTGCGGTCGGTGCGCTGCTCG
TGTACGATATCGCGAAGCACCTGTCCTATGAGAACGTGGAGCGATGGCTG
CGCGAGCTGCGCGATTACGCCGACCAGAACATTCTCATCATGCTCGTCGG
CAACAAGAGCGATCTCAGGCATCTCAGG
back to top

protein sequence of OSCA004970-RA

>OSCA004970-PA ID=OSCA004970-PA|Name=OSCA004970-RA|organism=Ostrinia scapulalis|type=polypeptide|length=176bp
VLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQI
WDTAGQERYRAITSAYXRGAVGALLVYDIAKHLSYENVERWLRELRDHAD
QNILIMLIWDTAAQERYRAITSAYYRGAVGALLVYDIAKHLSYENVERWL
RELRDYADQNILIMLVGNKSDLRHLR
back to top

mRNA from alignment at newscf_2004:38416..40663+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA004970-RA ID=OSCA004970-RA|Name=OSCA004970-RA|organism=Ostrinia scapulalis|type=mRNA|length=2248bp|location=Sequence derived from alignment at newscf_2004:38416..40663+ (Ostrinia scapulalis)
GTGCTAATAGGTGATTCGGGAGTCGGTAAAAGTAGTCTCCTATCTCGGTT CACTAGAAATGAATTTAACTTAGAGTCAAAATCCACAATAGGAGTGGAAT TTGCTACAAGAAGTATAGAGGTATGTTTCTTTGTTTCCTAGCAGCAGGTT GATAACAAGTTAAGCTTGTTTTTCTTTTGCTTAGAAGTGCTTTGTTTTGG TTTACCTACTTAACAGTTCCCAGTAACATTGAAATTGTTTTGTGACAGTG AGTATTTTTTATGAAATATTCATACAATGTAAGTAATGTTGCAGTTTAAT AATTACATTATATCAAACTTAATTCAAGCTCATGAATTGTAACCAGCTGC TGCTCACATGTTGTGCAATTTGCACTACTTTCACTAATATGGTTGTTGTG AACGATTAAAAATGCAGATGAGGTTGAGAGTAAGGATTCCCTTGTGTTGT AAATATTTATGGTAATAGAATACTGTTACTTTTGTGTATTTGTTACAGCT TTTAACTAAGACACTTAAGAGAGCATACTGTGTAATTAGGCAGAATTAAA AATTTGCCAGAAATACTTGAGTCACTGATACTTTTTCACTGCATTATTTG GTAGAAACCTTTGTTCATAATTTGGAAATGTGTCCATTTCTGCCAAGAGG GTATTCTCATGACATAATTCAGTTATGCTCATGCCTGTGGACCCGTCAGA TATGCCAAATCAAKTAGGGTCAATTGAATGTAACACATATTAGCCTTAAA CAGGACATGACCATAAATTTCCTGTATTCCAGTTTATTGTTAAGGATGTA TGCAGGTATTTAATTCTTATCACCATAGTTAGGTTATTTTGAGTCATAAA CAGTAGGAAATGTTTAAAAGATAAAAGTTTAATAGATGATGTCATATTAT TATAATGACCAGTATTTGGCATCTAAGGCACTTATCATTGGGAAAATAAT ACTTGTTCTTGTTTCTGGCTAAGGAACAATTGGTGAGGTGATAAAAAAAA AAATAACACTAAATCTAATCTATTGTAACATTGCTACTAATTTGTCATTT ATTTTTACTAATTTGGAACTCACCAAAGGTTAATTTCATTGATAACATTA TACACACATTAATTTTTTTGTGTGATTAATTGTGCAGTAATCTGGTAATT CAGTTATTACTGATGTATATGACCTAAMCAATTTGTGTTACTGGAAACTG TAAATCTGCTTAACATATTTAATTAATGAGATCATAAATTACTGAAAGTT TTTGTCTGGATACAGTATGTTATTGAGGAAACAATAATTGTTGAACTATT GATTTCTCAATAACATACTGTGTATAATTTAGCCAGAAAGACCAAAGAGT TAGCCCAAATTATTTAAATTAAATCATCATCTAATTGTACAGAAAGAATA AATATTTTTGAAGAAAAATTGTAGGTACATGTTGTAAGATTCTACAGTGT TTAGCTAGGTGTGCAGTTGTCTATCCAGCGACTTCAAATTATATGTATTT ATTTTTGTTTTTAATTGATGAATTTGCCTTTTACTCTCAGTCCACCTTAG GTTACAGATTTGAGTCTTAATTGAAATGYCTTTGCTTGTTTGCCTTGTGC CCCATAAAAAAATCATATACCAGTCATTGACGTTCCACTCGCATTCCAGG TCGACGGCAAAACCATAAAGGCCCAGATATGGGACACGGCCGGCCAGGAG CGGTACCGTGCGATCACGTCGGCGTACTAYCGCGGCGCGGTCGGTGCACT GCTCGTGTATGATATCGCGAAGCACCTGTCCTACGAGAACGTGGAGCGAT GGCTGCGCGAGCTGCGTGATCACGCCGACCAGAACATTCTCATCATGCTC GTCGGCAACAAGAGCGATCTCAGGCATCTCAGGTAATAACAGCTATAGCT ACAGAATGTCTTGTCGAATGTGGCAACATTCGTTTGCTTATTTCTGCGTC ATCGCGCTCATCAGAAGCCATAACACAACGTTCTGGTATCGCGGCGCTTA CGGAGCGTTCCTAGCGTACGATATAGGCCATAAAGGCCCAGATATGGGAC ACGGCCGCCCAGGAGCGGTACCGCGCGATTACGTCGGCGTACTATCGCGG TGCGGTCGGTGCGCTGCTCGTGTACGATATCGCGAAGCACCTGTCCTATG AGAACGTGGAGCGATGGCTGCGCGAGCTGCGCGATTACGCCGACCAGAAC ATTCTCATCATGCTCGTCGGCAACAAGAGCGATCTCAGGCATCTCAGG
back to top

Coding sequence (CDS) from alignment at newscf_2004:38416..40663+

>OSCA004970-RA ID=OSCA004970-RA|Name=OSCA004970-RA|organism=Ostrinia scapulalis|type=CDS|length=528bp|location=Sequence derived from alignment at newscf_2004:38416..40663+ (Ostrinia scapulalis)
GTGCTAATAGGTGATTCGGGAGTCGGTAAAAGTAGTCTCCTATCTCGGTT
CACTAGAAATGAATTTAACTTAGAGTCAAAATCCACAATAGGAGTGGAAT
TTGCTACAAGAAGTATAGAGGTCGACGGCAAAACCATAAAGGCCCAGATA
TGGGACACGGCCGGCCAGGAGCGGTACCGTGCGATCACGTCGGCGTACTA
YCGCGGCGCGGTCGGTGCACTGCTCGTGTATGATATCGCGAAGCACCTGT
CCTACGAGAACGTGGAGCGATGGCTGCGCGAGCTGCGTGATCACGCCGAC
CAGAACATTCTCATCATGCTCATATGGGACACGGCCGCCCAGGAGCGGTA
CCGCGCGATTACGTCGGCGTACTATCGCGGTGCGGTCGGTGCGCTGCTCG
TGTACGATATCGCGAAGCACCTGTCCTATGAGAACGTGGAGCGATGGCTG
CGCGAGCTGCGCGATTACGCCGACCAGAACATTCTCATCATGCTCGTCGG
CAACAAGAGCGATCTCAGGCATCTCAGG
back to top
Synonyms
The feature 'OSCA004970-RA' has the following synonyms
Synonym
maker-newscf_2004-snap-gene-0.18-mRNA-1