OSCA006352-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA006352-RA
Unique NameOSCA006352-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1721
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2002contignewscf_2002:55023..58031 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.08
QI303|1|1|1|0.5|0.6|5|788|209
AED0.08
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA006352OSCA006352Ostrinia scapulalisgenenewscf_2002 55023..58031 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006352-RAOSCA006352-PAOstrinia scapulalispolypeptidenewscf_2002 55326..57024 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006352-RA:exon:773OSCA006352-RA:exon:773Ostrinia scapulalisexonnewscf_2002 55023..55457 +
OSCA006352-RA:exon:774OSCA006352-RA:exon:774Ostrinia scapulalisexonnewscf_2002 56305..56472 +
OSCA006352-RA:exon:775OSCA006352-RA:exon:775Ostrinia scapulalisexonnewscf_2002 56551..56669 +
OSCA006352-RA:exon:776OSCA006352-RA:exon:776Ostrinia scapulalisexonnewscf_2002 56814..57118 +
OSCA006352-RA:exon:777OSCA006352-RA:exon:777Ostrinia scapulalisexonnewscf_2002 57338..58031 +


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006352-RA:five_prime_utrOSCA006352-RA:five_prime_utrOstrinia scapulalisfive_prime_UTRnewscf_2002 55023..55325 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006352-RA:cdsOSCA006352-RA:cdsOstrinia scapulalisCDSnewscf_2002 56814..57024 +


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006352-RA:three_prime_utrOSCA006352-RA:three_prime_utrOstrinia scapulalisthree_prime_UTRnewscf_2002 57338..58031 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA006352-RA ID=OSCA006352-RA|Name=OSCA006352-RA|organism=Ostrinia scapulalis|type=mRNA|length=1721bp
CAGTGTCAGCTGTCCTTGCTCGCTCAGTCCCTGTGTAATTTGTGATTCTG
TAAACTNACGAGTTTGTGAATGTTCGAACGTATTTTTTATTGCTGAAAAA
TTGAAAAATAGGAACTCGAGATTAACGTTCTTGTTCATTTGGTACGGCCG
CGATCAATAAGTTTGTTGTGGGCGTGATGTAAAAACAGTCCGTCACCTGT
TTTGAAACGTTTGTTCATACATATTTATTGCGTGTGTGCCGCTAATTTAA
TATTCGTAAATAGATAGTTAACGTGTAAAAACTAACACTATCGTGTTGTA
ATCATGAGTACTGCGGCTAACGGTTCATATAACTTCAAAGTAGTGCTATT
GGGCGAAGGATGCGTTGGGAAGACTTCCATACTATTGCGCTACATTGAGG
ACAAGTTCAATGACAAACATCTCACGACGCTCCAGGCAACATTTTTAAAC
AAAAAAATCAACATTAATGGCAAGCGCATAAACTTGTCAATCTGGGATAC
AGCTGGCCAAGAGAAATTCCATGCTTTGGGTCCGATTTACTATCGNAACT
CAAATGGAGCTATACTGGTCTATGATATTACAGATGAAGACTCGTTTGGG
AAGGTCAAAAATTGGGTGAAAGAACTGAAAAAAATGCTGGGATCTGACAT
AGTTCTTGTGATTGCTGGTAATAAAATTGACTTGGAACATGANAGAACTG
TACCACTTGAAGAAGCAGAAAGTTATGCAACCATGGTAGGTGCGAAGCAT
TTCTACACATCTGCAAAATTAAATCAAGGTGTAGAAGATCTATTCCTTGA
ACTAACACGCGAGATGTCAGAAAGGCTTGAANGCAACTCCCAGGCTGATG
TGTCCAGGACGTCCAGGGTTCTAGTGGTTGAAGATGAAGCTCCAGCTCAG
ACGTCGTGCTGTGGTGGTGCTAAACNTAACTAATCTCAATTAATATTGAT
AAAAAGTTATAAAATGGGTATTGTGTTGTATGGAAATTTTAAGCAGGTAT
ATTTTATTAAACTCTTAAATATTAATAATAATGAGATTGAGAAGAATCTT
CCATTGTGAGCAAGTAAGAAGATCAGCTTCAATTAAGATCTAAAGATGAG
CTGATTCATATTTATCTACACATAATTATGATTATGTTTCACTCTTAATG
GAAATATTCTCTATTTTAATAGGTTTAATTTAAGTCATTTTTGCTTATAT
AAATTTATATTCATTTGTTATTATGAAGATTACTAAAATTATTTGATAGA
ATGAGAAATTCAGACATCTTTAGTCATTGCCAAAATATTGTTTTAGAGAC
TATAATAATCTTCGTTTTTCTTCTAAGATAAGATAAAACTACAATATTTT
TTGTTATCTCAAATTACAATTTCATGTTAAGCTTCAGCATTATCNAGATT
TCTTTGTCTTCTGTGTAGGTGTCGCTTTGTCAAATAGCTTACAGTTTATA
AAATATCATATTTAATTAGTGAACCAAAGATAATTATGTTATAAATTTAT
TGATCCACTCATAAAATATATTGTATATCTAACAGCATTGATATCGCCAT
ATTTATTGAATTTTAATTTTATCTTATGTTATTAAGAATAACTATAGTAG
TTGAAACACTACATCATGTTTGACATAGAAAGAATGATAAAGTGCACTGT
GTCTGCTGCGTTAGCTGTAATGGTTTATTACATCATATTTTGATTACTAA
GTAGGCGCGCACACCGTTGAT
back to top

spliced messenger RNA

>OSCA006352-RA ID=OSCA006352-RA|Name=OSCA006352-RA|organism=Ostrinia scapulalis|type=mRNA|length=1721bp|location=Sequence derived from alignment at newscf_2002:55023..58031+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
CAGTGTCAGCTGTCCTTGCTCGCTCAGTCCCTGTGTAATTTGTGATTCTG
TAAACTRACGAGTTTGTGAATGTTCGAACGTATTTTTTATTGCTGAAAAA
TTGAAAAATAGGAACTCGAGATTAACGTTCTTGTTCATTTGGTACGGCCG
CGATCAATAAGTTTGTTGTGGGCGTGATGTAAAAACAGTCCGTCACCTGT
TTTGAAACGTTTGTTCATACATATTTATTGCGTGTGTGCCGCTAATTTAA
TATTCGTAAATAGATAGTTAACGTGTAAAAACTAACACTATCGTGTTGTA
ATCATGAGTACTGCGGCTAACGGTTCATATAACTTCAAAGTAGTGCTATT
GGGCGAAGGATGCGTTGGGAAGACTTCCATACTATTGCGCTACATTGAGG
ACAAGTTCAATGACAAACATCTCACGACGCTCCAGGCAACATTTTTAAAC
AAAAAAATCAACATTAATGGCAAGCGCATAAACTTGTCAATCTGGGATAC
AGCTGGCCAAGAGAAATTCCATGCTTTGGGTCCGATTTACTATCGRAACT
CAAATGGAGCTATACTGGTCTATGATATTACAGATGAAGACTCGTTTGGG
AAGGTCAAAAATTGGGTGAAAGAACTGAAAAAAATGCTGGGATCTGACAT
AGTTCTTGTGATTGCTGGTAATAAAATTGACTTGGAACATGAWAGAACTG
TACCACTTGAAGAAGCAGAAAGTTATGCAACCATGGTAGGTGCGAAGCAT
TTCTACACATCTGCAAAATTAAATCAAGGTGTAGAAGATCTATTCCTTGA
ACTAACACGCGAGATGTCAGAAAGGCTTGAAYGCAACTCCCAGGCTGATG
TGTCCAGGACGTCCAGGGTTCTAGTGGTTGAAGATGAAGCTCCAGCTCAG
ACGTCGTGCTGTGGTGGTGCTAAACRTAACTAATCTCAATTAATATTGAT
AAAAAGTTATAAAATGGGTATTGTGTTGTATGGAAATTTTAAGCAGGTAT
ATTTTATTAAACTCTTAAATATTAATAATAATGAGATTGAGAAGAATCTT
CCATTGTGAGCAAGTAAGAAGATCAGCTTCAATTAAGATCTAAAGATGAG
CTGATTCATATTTATCTACACATAATTATGATTATGTTTCACTCTTAATG
GAAATATTCTCTATTTTAATAGGTTTAATTTAAGTCATTTTTGCTTATAT
AAATTTATATTCATTTGTTATTATGAAGATTACTAAAATTATTTGATAGA
ATGAGAAATTCAGACATCTTTAGTCATTGCCAAAATATTGTTTTAGAGAC
TATAATAATCTTCGTTTTTCTTCTAAGATAAGATAAAACTACAATATTTT
TTGTTATCTCAAATTACAATTTCATGTTAAGCTTCAGCATTATCWAGATT
TCTTTGTCTTCTGTGTAGGTGTCGCTTTGTCAAATAGCTTACAGTTTATA
AAATATCATATTTAATTAGTGAACCAAAGATAATTATGTTATAAATTTAT
TGATCCACTCATAAAATATATTGTATATCTAACAGCATTGATATCGCCAT
ATTTATTGAATTTTAATTTTATCTTATGTTATTAAGAATAACTATAGTAG
TTGAAACACTACATCATGTTTGACATAGAAAGAATGATAAAGTGCACTGT
GTCTGCTGCGTTAGCTGTAATGGTTTATTACATCATATTTTGATTACTAA
GTAGGCGCGCACACCGTTGAT
back to top

protein sequence of OSCA006352-RA

>OSCA006352-PA ID=OSCA006352-PA|Name=OSCA006352-RA|organism=Ostrinia scapulalis|type=polypeptide|length=209bp
MSTAANGSYNFKVVLLGEGCVGKTSILLRYIEDKFNDKHLTTLQATFLNK
KININGKRINLSIWDTAGQEKFHALGPIYYRNSNGAILVYDITDEDSFGK
VKNWVKELKKMLGSDIVLVIAGNKIDLEHXRTVPLEEAESYATMVGAKHF
YTSAKLNQGVEDLFLELTREMSERLEXNSQADVSRTSRVLVVEDEAPAQT
SCCGGAKXN
back to top

mRNA from alignment at newscf_2002:55023..58031+

Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA006352-RA ID=OSCA006352-RA|Name=OSCA006352-RA|organism=Ostrinia scapulalis|type=mRNA|length=3009bp|location=Sequence derived from alignment at newscf_2002:55023..58031+ (Ostrinia scapulalis)
CAGTGTCAGCTGTCCTTGCTCGCTCAGTCCCTGTGTAATTTGTGATTCTG TAAACTRACGAGTTTGTGAATGTTCGAACGTATTTTTTATTGCTGAAAAA TTGAAAAATAGGAACTCGAGATTAACGTTCTTGTTCATTTGGTACGGCCG CGATCAATAAGTTTGTTGTGGGCGTGATGTAAAAACAGTCCGTCACCTGT TTTGAAACGTTTGTTCATACATATTTATTGCGTGTGTGCCGCTAATTTAA TATTCGTAAATAGATAGTTAACGTGTAAAAACTAACACTATCGTGTTGTA ATCATGAGTACTGCGGCTAACGGTTCATATAACTTCAAAGTAGTGCTATT GGGCGAAGGATGCGTTGGGAAGACTTCCATACTATTGCGCTACATTGAGG ACAAGTTCAATGACAAACATCTCACGACGCTCCAGGTAGGTGGTCTAATT AATTTCGCATATTACGTACATATGCGACTGAGKTGAATGTCGTAACAATA ACTATGGCGACGAAACACTAGTTTATGATCAACCTACAGTAGGACTATCA CTTACCAGTACCTGCTATTGGAATACAATAACTATCCAGGAAATCTGGCT GGGGTTTTCAAATGAAGAAGTTTTGTCTTATTTCTGAACTTAAGGTCTTT GTCTGGTAATAGCCATTTTGGTGATGGCAGCTTTGTTAATAATAACTGAT GTAGCTATTGGTATCTTTAATTTGCTGAAAAACATTTACTTAATATGGAT AATGGATATATGCTTAATGGAATTGGACTTCATTTATTAGATAGTTAATA CAAACCTATATTTTAAATCAATCTTATTTGATTTTGAATCTATGTCATAT CACAGATACTAAGATGAACATATTATAGTAATTGAATACAACAGAGGAAT GCAGTGAGGAACTGCAGTTTAAAATGTGTTCTTGCATAATAACAATTATG TTTAATATTAATTTGTGTTCYAGTTATCTCTGTCATTTGAAAATGCATAA TAACAATAATGTTTAATATTTATTTGTGTTCTAGTTATCTTTGTCATTTG AAAAACTAAGTACTACATAGAATGCTTAACACTTCCATGAACAGTGAACT GTTAAACTTGTATTGTGTCTGGGTTACTGTCCGTGAAAGTGTTAATAGTA TTTTTGAATCATCAATCATGCAATAATCACAGGTAGATGACAGATAAAAA TACTGACTATTCACAACAAAGACTATTGTAGGGGTCTGTATCTACGTCAC TAGCTAGTCACTCAATTTACTCTCTATTCCAGGCAACATTTTTAAACAAA AAAATCAACATTAATGGCAAGCGCATAAACTTGTCAATCTGGGATACAGC TGGCCAAGAGAAATTCCATGCTTTGGGTCCGATTTACTATCGRAACTCAA ATGGAGCTATACTGGTCTATGATATTACAGATGAAGACTCGTTTGGGAAG GTAGGATCTACTAATAACAGATCATTAATAAAGAAACAGAGCATTTTAGT TATCAACTTATTCATATTTTTATTTTAGGTCAAAAATTGGGTGAAAGAAC TGAAAAAAATGCTGGGATCTGACATAGTTCTTGTGATTGCTGGTAATAAA ATTGACTTGGAACATGAWAGAACTGTACCACTTGAAGAAGCAGAAAGGTA AATAAACTAACCAACTCCTTCAACAAAACTGAATATCCCATAGAACTTTT TTGTCTGTTTGGACCTCTATTTATATAGGAATTAGCTACAAATAGGATAG CTATGGTATAATAAATCTGAAATATTCATGTTTTCTTTCAGTTATGCAAC CATGGTAGGTGCGAAGCATTTCTACACATCTGCAAAATTAAATCAAGGTG TAGAAGATCTATTCCTTGAACTAACACGCGAGATGTCAGAAAGGCTTGAA YGCAACTCCCAGGCTGATGTGTCCAGGACGTCCAGGGTTCTAGTGGTTGA AGATGAAGCTCCAGCTCAGACGTCGTGCTGTGGTGGTGCTAAACRTAACT AATCTCAATTAATATTGATAAAAAGTTATAAAATGGGTATTGTGTTGTAT GGAAATTTTAAGCAGGTATATTTTATTAAACTCTTAAATATTAATAACTA GCTGACCCAGCGAACTTTGTTCCGCCTTAATGGCAATAAATGAGCAGACT TTTTTTTTAATTTCGTACGGGATAAAAAGTATCCTATGTCCTTCTCCTGG CTCTGAACTACCTCCCTGACAATTTTCAGCTAAATCGGTTCAGCCGTTCT TGAGTTATAAGCGGAGTAACTAACACGACTTTCTTTTATATATATAGATT CTTTTATATATATAGATAATGAGATTGAGAAGAATCTTCCATTGTGAGCA AGTAAGAAGATCAGCTTCAATTAAGATCTAAAGATGAGCTGATTCATATT TATCTACACATAATTATGATTATGTTTCACTCTTAATGGAAATATTCTCT ATTTTAATAGGTTTAATTTAAGTCATTTTTGCTTATATAAATTTATATTC ATTTGTTATTATGAAGATTACTAAAATTATTTGATAGAATGAGAAATTCA GACATCTTTAGTCATTGCCAAAATATTGTTTTAGAGACTATAATAATCTT CGTTTTTCTTCTAAGATAAGATAAAACTACAATATTTTTTGTTATCTCAA ATTACAATTTCATGTTAAGCTTCAGCATTATCWAGATTTCTTTGTCTTCT GTGTAGGTGTCGCTTTGTCAAATAGCTTACAGTTTATAAAATATCATATT TAATTAGTGAACCAAAGATAATTATGTTATAAATTTATTGATCCACTCAT AAAATATATTGTATATCTAACAGCATTGATATCGCCATATTTATTGAATT TTAATTTTATCTTATGTTATTAAGAATAACTATAGTAGTTGAAACACTAC ATCATGTTTGACATAGAAAGAATGATAAAGTGCACTGTGTCTGCTGCGTT AGCTGTAATGGTTTATTACATCATATTTTGATTACTAAGTAGGCGCGCAC ACCGTTGAT
back to top

Coding sequence (CDS) from alignment at newscf_2002:55023..58031+

>OSCA006352-RA ID=OSCA006352-RA|Name=OSCA006352-RA|organism=Ostrinia scapulalis|type=CDS|length=630bp|location=Sequence derived from alignment at newscf_2002:55023..58031+ (Ostrinia scapulalis)
ATGAGTACTGCGGCTAACGGTTCATATAACTTCAAAGTAGTGCTATTGGG
CGAAGGATGCGTTGGGAAGACTTCCATACTATTGCGCTACATTGAGGACA
AGTTCAATGACAAACATCTCACGACGCTCCAGGCAACATTTTTAAACAAA
AAAATCAACATTAATGGCAAGCGCATAAACTTGTCAATCTGGGATACAGC
TGGCCAAGAGAAATTCCATGCTTTGGGTCCGATTTACTATCGRAACTCAA
ATGGAGCTATACTGGTCTATGATATTACAGATGAAGACTCGTTTGGGAAG
GTCAAAAATTGGGTGAAAGAACTGAAAAAAATGCTGGGATCTGACATAGT
TCTTGTGATTGCTGGTAATAAAATTGACTTGGAACATGAWAGAACTGTAC
CACTTGAAGAAGCAGAAAGTTATGCAACCATGGTAGGTGCGAAGCATTTC
TACACATCTGCAAAATTAAATCAAGGTGTAGAAGATCTATTCCTTGAACT
AACACGCGAGATGTCAGAAAGGCTTGAAYGCAACTCCCAGGCTGATGTGT
CCAGGACGTCCAGGGTTCTAGTGGTTGAAGATGAAGCTCCAGCTCAGACG
TCGTGCTGTGGTGGTGCTAAACRTAACTAA
back to top
Synonyms
The feature 'OSCA006352-RA' has the following synonyms
Synonym
maker-newscf_2002-snap-gene-0.13-mRNA-1