OSCA006362-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA006362-RA
Unique NameOSCA006362-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length489
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1865contignewscf_1865:39558..50756 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.43
QI0|0|0|1|0.5|0.6|5|0|162
AED0.41
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA006362OSCA006362Ostrinia scapulalisgenenewscf_1865 39558..50756 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006362-RAOSCA006362-PAOstrinia scapulalispolypeptidenewscf_1865 39558..50756 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006362-RA:cdsOSCA006362-RA:cdsOstrinia scapulalisCDSnewscf_1865 39558..39577 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006362-RA:exon:955OSCA006362-RA:exon:955Ostrinia scapulalisexonnewscf_1865 39558..39577 -
OSCA006362-RA:exon:956OSCA006362-RA:exon:956Ostrinia scapulalisexonnewscf_1865 41287..41396 -
OSCA006362-RA:exon:957OSCA006362-RA:exon:957Ostrinia scapulalisexonnewscf_1865 49376..49495 -
OSCA006362-RA:exon:958OSCA006362-RA:exon:958Ostrinia scapulalisexonnewscf_1865 49940..50103 -
OSCA006362-RA:exon:959OSCA006362-RA:exon:959Ostrinia scapulalisexonnewscf_1865 50682..50756 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA006362-RA ID=OSCA006362-RA|Name=OSCA006362-RA|organism=Ostrinia scapulalis|type=mRNA|length=489bp
ATGCTGGGTTTCTTCGCTCTGGCAGCCGGTGGATTCATATTGTTCCTACA
TCCATACGACTTCTTATTCAAACAGAAAGTGGTCCTCCAAGATGGCGGCG
AGATCTTCGAGATGTGGCGAAAGCCAGAGGTGGATCTTTACTGCCGAGTG
TTCCTGTTCAACATCACCAATGCTGAAGAGTACATGGCTGGTACTGCAGA
CAAGATTATTGTGAAGGAAGTCGGCCCTTACGTCTACAAAGAAGCCTTAG
AGCATGAAGTGAAGACCTTCAACGAGAATGGGACCCTATCAGCTATACCG
AGGCATCCTCTGACCTGGGTGGAGGAACTGTCTGAGGGTCATAAAGAAGA
TGACATCCTCATAGCCAACGTGGTAGCGCCCCAGGGCTTCATGACGCGCT
TCGGACTGAATAACCTGATCAGCCTCACCAACACCAAGCCTCTGGCCAAG
ATGACAGCGAAAGANTTATCAAAAAACCTAATATTTTAA
back to top

spliced messenger RNA

>OSCA006362-RA ID=OSCA006362-RA|Name=OSCA006362-RA|organism=Ostrinia scapulalis|type=mRNA|length=489bp|location=Sequence derived from alignment at newscf_1865:39558..50756- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGCTGGGTTTCTTCGCTCTGGCAGCCGGTGGATTCATATTGTTCCTACA
TCCATACGACTTCTTATTCAAACAGAAAGTGGTCCTCCAAGATGGCGGCG
AGATCTTCGAGATGTGGCGAAAGCCAGAGGTGGATCTTTACTGCCGAGTG
TTCCTGTTCAACATCACCAATGCTGAAGAGTACATGGCTGGTACTGCAGA
CAAGATTATTGTGAAGGAAGTCGGCCCTTACGTCTACAAAGAAGCCTTAG
AGCATGAAGTGAAGACCTTCAACGAGAATGGGACCCTATCAGCTATACCG
AGGCATCCTCTGACCTGGGTGGAGGAACTGTCTGAGGGTCATAAAGAAGA
TGACATCCTCATAGCCAACGTGGTAGCGCCCCAGGGCTTCATGACGCGCT
TCGGACTGAATAACCTGATCAGCCTCACCAACACCAAGCCTCTGGCCAAG
ATGACAGCGAAAGANTTATCAAAAAACCTAATATTTTAA
back to top

protein sequence of OSCA006362-RA

>OSCA006362-PA ID=OSCA006362-PA|Name=OSCA006362-RA|organism=Ostrinia scapulalis|type=polypeptide|length=162bp
MLGFFALAAGGFILFLHPYDFLFKQKVVLQDGGEIFEMWRKPEVDLYCRV
FLFNITNAEEYMAGTADKIIVKEVGPYVYKEALEHEVKTFNENGTLSAIP
RHPLTWVEELSEGHKEDDILIANVVAPQGFMTRFGLNNLISLTNTKPLAK
MTAKXLSKNLIF
back to top

mRNA from alignment at newscf_1865:39558..50756-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA006362-RA ID=OSCA006362-RA|Name=OSCA006362-RA|organism=Ostrinia scapulalis|type=mRNA|length=11199bp|location=Sequence derived from alignment at newscf_1865:39558..50756- (Ostrinia scapulalis)
ATGCTGGGTTTCTTCGCTCTGGCAGCCGGTGGATTCATATTGTTCCTACA TCCATACGACTTCTTATTCAAACAGGTAGGTAAAACACATTTTATTGAAC ACAAGAAAAGAAAAAAAAAGAAAGAAATACACAAAAGATTAGGCGGTACT TTCGCTATAAATCGATCTCTTCTAGACAACCTAGTTTCAAATAACAGAAT CTATTTATTTATCTCAAAATGGTTATAATTGCATAATATCACAGTAACTC TTGTTACCTTTTCACGCTAAAACCACTGTACTGATTTAGAAGAAGACATA GTTGGACACCTTGGGAAAAATATAAAAAAATAACAGAGGGCTACATTTTC AAAAAGTAGGCTCTCAAAGAGCACTTTTACACTTATGTACCAACCAACCC TACCACTGCTTCGGGACAGTAATATGAACCAGTGCTGAGAAGAAGCAGCG CAAGAAACTTACACCCGTTTTCACAAACATTACTATGAGGTCTCACAGTG CGCGTGGACGCACAGGATGATACACGAACCAATCACAGAGCTCTATTCAA CGCTGTGGGTTCAATTTGCTGCTTCACTTAACCAAGCATCGTTTGTGAAT ACGGGCATTAGTCACAACTAACCAATAAGTGTAATCTCAATGGTATCTTC CAGAAAGTGGTCCTCCAAGATGGCGGCGAGATCTTCGAGATGTGGCGAAA GCCAGAGGTGGATCTTTACTGCCGAGTGTTCCTGTTCAACATCACCAATG CTGAAGAGTACATGGCTGGTACTGCAGACAAGATTATTGTGAAGGAAGTC GGCCCTTACGTCTACAAGTGAGTCCATCATCATTAGAATCTACTGCAGGA GCACGACTATGTCGCTTTATTTCGTGCGTTCGTTTCAGCCGAAAGATGTG CACTGCTGCACAAAGGCCTCCCTCAAGATTTTCTACAAAGACCGGTCCTG CGCCGTCCGCATCCAGTCACCTCCCGCAACCTTCACCAAATCGTCGGTCC ACCTAGTGGGAAGCCTACCCACATTACGACTTCTGGCTCGTGGTCGCCAC TCGATTTTCTGCCCCAGCGACCATCAGCTCTACGAGCTATGCGCCCCGTC CTATTTTTTAACCAAAGGCAAATGGAAAATAAGTCTTACGGGTTTGTAAA GACTAGAGTGCATCAAGCCAAACGCTATGGCATCTATGGATTTCTTTTAG GTCATATTTTCCATGAAAAAAATGATATTTTGTAGACTCTACATAACTTT TTCTCTTTCAGAGAAGCCTTAGAGCATGAAGTGAAGACCTTCAACGAGAA TGGGACCCTATCAGCTATACCGAGGCATCCTCTGACCTGGGTGGAGGAAC TGTCTGAGGGTCATAAAGAAGATGACATCCTGTATCTACCTCATATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGCATGACCCTC TAATTTTCCAGAGGCATATGGAGGATTTTGCCTACACTCCCCACACTGGC TGGTCAGGTTGAAAAGGCCCGATGTTCACATTATTATTTGTGCCTTAGTC GCTATTTACGACATCCACGGGAAGAGTAGGTGTGGTACTATATAAGGTAC TATTCTACTCTACTGGAACCATACCGCTTTAACAACATTTGATTTTGATT TTTGATTTTGATATAACCCAAACCATACTATAACATTATTTCTCATTGCA ATCAAAGATAACTTTTCTTAAATTAAGGCTAGTGTAAATTTAATAGGTCT TATTAGTGTTCAAGATTGCCAAAGTATGTTGGCATGGACTATGAGTAAGT AAGAGATACAGGGGCATTTTCGTTAAAAATTACTCGATCTATTAGTTTTC AAGATTGCCAATGTTTCTTAACATGGACTAGCCAGGTCAAAACCAGTTGG CAACCCGTAACCTTTAGGGTAATCAAATAAAATTCTAATTCCTTTCCTAA AGCCACATTTCTGCATTTCGACACAACACATATCCGGAGTGGAACTGCAC GTAGAAGGCTCTAGTGCGTTTCCTAATGTTTAAGTAGCTAGTGACGTGCG AGGTGTCGATAAAACCGGATATTGTCGATGGAAAGCTAGCAGACCACCGA TTTTTGTTGGCCCATAGTTGGGTCGGGCTGTTGGTCAGTATGGAGATGTA TGAAAGTGCGCACATTACACCGATTTGGTATCGGCCGATTCTTCGTACAA ATTAGAATCGGGCCCAACTATCGGCCAACTAAAAGTCGGTGGTCTGCACC TAGGCTAAACCGTATTTTAGAGAATCAATCATTAGGTCTAAAGCTATTGT TTAAGTAGCACAATACTATAATAAATTACCTTATCAGGAAGTTTTCATAT TAAATCAATCAATTCTGTATTTAACGAATCTGGTTTATGAGCTCACTACA ATAGCATGATATATCTTAGGTACATGCATTATGTACAATACAATAGGTTA AAATGACATAATTTAGTTGTTCTTATGACTAGGATACGATCTCTCTTTTC TAAGCAACCCAGAGATAGAAATCAAATTAAATCAGATCATTAAATGCCAT CGTGGTCCAGTACATAAAGTTAAAACTCACTCAAAAGTTTAATTTCAAAA TAGGATCAATAGGTACACACAATTTAAACAAACAATGCTGGCTCATCATC ATCATCATCATTTCAGCCACAGGACGTCCACTGCTGAACATAGACCTCCC GCAATAATTTCCATATAGCTAGACAATCTAGTGTACCTAATTAACGGAAA ATAAAGGTGATTGTGTCTAATTTATCATCCGATTAAGACATATTAAATCA GACATTAATCTAAAGTCGTTTATCTAAACCGGAACAACGAAAACCGGAAA TATATCGATATTTTCCGGTTGCTTGCGCATCACTACGACAGCTCCTAGTT TTGTAAGACATTGATACTCGCTATTCAGATGGATTGGTATTGGGCAAGTT TATTCACTACTCAGTTGATTTTATGGTTAACAGTTAACTGACAGGCGTGT AATGTCAGATGACGGCACATATTTTAATGCACATACGCCCGTATTCACAA ACGATGCTTGCTTAAGTGAAGCAGCAAATCGATCGCACAGCGTTGAATAG AGCTCGTGATTTTTTTTAATGCTAGACAAGGCAGGTATTTGACCACAATC GCACCTTTCGATTGGTTCGTGTGTCACCCTGTGCGTCCACGCGCACTGTG AAACCTCATAGTAATGTTTGTGAATACGGATAGAATGCGCTATTTTTAAC AAATGATACCTACTTAATTTGACAGTCAGGAGTGTTGTATACTATTAAGT CGAATTGCTCAATTGAGGAATTATTTATTAAAGCTTTATACAACTTGAAT GCCCTTTGAAATAATTACTTATGGTTAAGTACCTATACGGCCGGAGTGTG CGAGCGCGACAGCAACGTAATTACGCGCGAGCGATAAGGATGGGTAACTT GGGGTCATTGGACGAAATTCTACGTGCTCGGCGACCGGGCTTTAGACTTA AAATGTTGGTAAAGTAATTTTAGTACGGTCTAGCTTAACTCAGTCACTGC CTGAGGTATGGAAGCGGCAAGGGTGTGTTTGGGAGGTCAAACGTCACTCA TAACTGTTAACACTCATGTTTTCTTTTATTTCATTAACTGACGGCACTAA ATCTCATTATATCAAAGAATAAATTAAATGGGACGAATCCAGAACAAAAA ATATGTATTTTTTTTAATTCAGTGTTTCGTCCCAGTGGGACGAACCTGTT GTGGGACGAATCACTGAACTAGCCCCCCTCCCGTGCCGCTCCCATGCCTC AGGCACTGACTGAGTAACGAGCTATACCTGAACCTATACTCGTAGCTATT GCCCACGACTTGATCAACTGAGGAATTGTTGTGAGCAATAAATATTTCGT GTTTATGAAATTAAGATAGCTTAAGGCTTTTGTTCCAAAAAGAGGTTAAA GATCTAGTTAATACTTATTAGTTAAAACACTATCGCTTATTGTAATAATA ATTAGTCAATTAATTACTTTGATTACATCTTTAGACGTCACATAAAATGG CGCCATTTTGAATAATTATAACTCATTAGTTTGATTGGTAATTTGGGACA AATTACTAGAATAATTGAGATGCAANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNATCTAGATTTTACGTTAGGAAATAG CTGAATCATATGATTACTTTGATAGATAGTGTTGTTGGATGTCAGTTTTA TCGATAGTCGATGTTTAGAAATCAAGAAGCTGACATTTTTTTATGAACGT CACATTTAAAATTAAGGTTATAATTACTTAAAGTACGGGACTATTCCCAC CTCTCGTTCCCACCGCTACAACTCCTGTGTAGCCAGGATCTACAGCTTGA CCGCCAATAAAAGTACTAGAGCTACGTGAAAAAAAATTTGTTAAGTCAGC GTCAAATACTTAGTTCGTGACACCCAAAGTAGCCAAAAAGTTCGCCACAC GTCTTTGTTTCAATTGAAATAAGAGTGTTGTCAACTTTTTGGCTACTTTG GGTGTCACGAACTGTTTGACGCTGACTGTACCTATAATTAAAACAAAGTA AACAAAACTACTACTCAAATGTCATAATCGTAAATTTAAGTGTTTGTACG TTATTTAGGCATGCCTAAGCCATTGCGAAATAAGCACTAACCTGAGCAGT ACTTAGCGTTTCGACATGACCTATGCTAAGATACTTTGATGAGCACTAAA CGAAATAACTAGTTTTGAAGGTTTATGTGTTGAGTGCGTGAATGACTGTT CAAATAGAAGCTATAGCACAGAATAATAAATAAACTACGTACAGTGGGTC TAGACAAAGTGCAAATTATAATCGCAAACCAGTCGANNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGACCCCTATGGTAACAAATA ACAGGAATTTTGTTTACATAGGGGTTACTTAAAAATTAAGGATTGATGGT GAAAACGGGCATTAGCCCACTTTTAGCTTGGTCTACGGGCCAAGTCACTG GTTTGAAATTTAAATAGCTTTTCTTTCATGGGCCCGCCTTCAATGTTTTA TTAATAAATTAAATACCAAATCAACAAAAATCTTCTCTAAAATCTTAGAG GTGGGCCCAGTCACTGGAAGAAAATAACTATTTAAAAATTCAAACCAGAG ACTTGGCCCGTGGACTAAACTAAAATTGGCCAAGAAGTTACTGGAAGACT CGTTTTAGAGAAGCCAAAAGTCAACGAGACTTCAGATATTCATCAGGTTT GTATGCTCTGTCTCGTCATAATATATCAATGTCACCCTTCCCATGCCGCT CCCATACCTCGGGCACTTACTGAATTAGAAAGAAAGAAAAACATTTATTT TGGTTCTAACATAAATAAAAAATACATACACAGTTGGATTATTATAGGGA GTTCGAACCAAATATGGCTACCACTCAGCATGTGTCATGCTCTGAGGGTA GAACTCAGAACATGACGCTGTTATTCTGCGGAAACCAGGAGTTAAACTGG TTAAACCTACCTATAGTGATTTAGTAAAACCTAAATAAAATGTAATCTTC TTTTCCAGAGCATAGCCAACGTGGTAGCGCCCCAGGGCTTCATGACGCGC TTCGGACTGAATAACCTGATCAGCCTCACCAACACCAAGCCTCTGGCCAA GATGACAGCGAAAGANTTATGTATATTTAGATAGTACGGGACTATTCCCA CCTCTCGTTCCCACCGCTGCAACTCCTGTGTAGCCAGGATCTACAGCTTG ACCGCCAATAAAAGTAGGTACCAGAGCTACGTGAAAAAATTGGGTGTAAA TTGTTGACGCTGACTGTACCTATAATTAAAACAAAGTAAACAAAACTACT ACTCAAATGTCATAATCGTAAATCTATAGTAATTTTAAGTGTTTGTGTGT TATTTAGGCATGCCTAAGCCATTGCGAAATAAGCACTAACCTGAGCAGTA CTTAGCGTTTCGACATGACCTATGCTAAGATGTTTTGATGAGCACTAAAT GAACTAACTAGTTTTGAAGGTTTATGTGTTGAGTGCTGTGAATGACTGTT TAAATAGAACCTATATGTCTAGTGCTTAGTCAGTCAGTGCCTGAGGTATG GGAGCGGCATGGGAGGGTTTTTTAGAGTCTTCCTGTGACTTGGCCCACTT TTAGCTTGGTCCACGGGCCAAGTCGCTGGTTTGAATTTTCTTTCAAAGTC AAAGTTTNAGCTTTCATACTGATATCATGCTTGGTTATTTTTAAATAAAA TGTTAAAGTCGTAAGAGCCTTAATATACCGAAGTAGGGGGCACTTACCTT ACCATATCAACAAAAATCTACTCTAGAATCTTAGAGGTGGGCCCAGTCAC TGGAAGAAAATAACTATTTAAACATTCAAACCAGAGACTTGGCCCGTGGA CTAAACTAAAATTGGCCAAGAAGTTACTGGAAGATTCGTTTTAGAGACGC CAAAAGTCAACGAGACTTCAGATATTCTTCAGATTTGTATTCTCTGTCTC GTCATAATATATCAATGTCACCCCTCCCGTGCCGCTCATACCTCAGGCAC TGGCTGAGTTAAGCCTACCTATAGTTATTTTGTAAAACCAAATAGTGACT GAGTTTTTTGCGCTGCTTCTTCTCAGCATCTATAGTCCCGAAGCAGTGGC CCCAATCCTTCCCCCGGATACGCCTGAGCCGTAATCCGAGCCTACCCTGG CGCCTTCAGGCCGCGTCCGTAGTCCCCTCGATCGGGCCCACTAGAGTGAG CCCGCCGTAGGCTGGACTTTGGTCCAACACCGCGGGGGGCAACCCTCTAG TTGGGTTCGCCACTGATCGGGCGCCTTATGCGCTCGATACGGCCCGATCG CGAACGTCNCAGGAGCACGACTCTTTAATTTACCAGAGGCAAATGGAGGA TTTGGCCTACACTCCCCACGCTGGCCTTCTTATACTATCGTTCCTACCGG TAGAAACTTCTGTATGCATCTGATACGAATCGCATCGTCCACTTAAATCG TATCCCTTCTTCACAATGCAACTCCTGTACAACCAGGACCTATGGTTTGC CCATTATGAAACCCAACAAGTGACTTCAGTAGTTCAAGAGAATAGCTAAC TCTTCAAAAATAATTAGAACAGTATACGACTATTTGGACTCTCTTTCATG AGTTTTCATTGCGGTATCCAATTATTTTCTAAAATAAAAGTACGAGTATC CTAAGTTACCTATAAACATCCAATATCTATTTCTATTTCCTATCTGTTAG ATCACAACCAAAATAGATCCAGCCGTTTCGAAAATTTTGCTTATACACTT ATTCCTATTTTCCTTCTTCTTTCTTCAATTTCTTTCTTCATTTCCTTTCA TTCTTCATTCTTATTCACATTTCCTTTAGCAAAAAACCTAATATTTTAA
back to top

Coding sequence (CDS) from alignment at newscf_1865:39558..50756-

>OSCA006362-RA ID=OSCA006362-RA|Name=OSCA006362-RA|organism=Ostrinia scapulalis|type=CDS|length=489bp|location=Sequence derived from alignment at newscf_1865:39558..50756- (Ostrinia scapulalis)
ATGCTGGGTTTCTTCGCTCTGGCAGCCGGTGGATTCATATTGTTCCTACA
TCCATACGACTTCTTATTCAAACAGAAAGTGGTCCTCCAAGATGGCGGCG
AGATCTTCGAGATGTGGCGAAAGCCAGAGGTGGATCTTTACTGCCGAGTG
TTCCTGTTCAACATCACCAATGCTGAAGAGTACATGGCTGGTACTGCAGA
CAAGATTATTGTGAAGGAAGTCGGCCCTTACGTCTACAAAGAAGCCTTAG
AGCATGAAGTGAAGACCTTCAACGAGAATGGGACCCTATCAGCTATACCG
AGGCATCCTCTGACCTGGGTGGAGGAACTGTCTGAGGGTCATAAAGAAGA
TGACATCCTCATAGCCAACGTGGTAGCGCCCCAGGGCTTCATGACGCGCT
TCGGACTGAATAACCTGATCAGCCTCACCAACACCAAGCCTCTGGCCAAG
ATGACAGCGAAAGANTTATCAAAAAACCTAATATTTTAA
back to top
Synonyms
The feature 'OSCA006362-RA' has the following synonyms
Synonym
maker-newscf_1865-snap-gene-0.16-mRNA-1