OSCA007257-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA007257-RA
Unique NameOSCA007257-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1206
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2583contignewscf_2583:247..5736 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.12
QI0|0|0|0.75|0.66|0.75|4|0|401
AED0.12
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA007257OSCA007257Ostrinia scapulalisgenenewscf_2583 247..5736 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA007257-RAOSCA007257-PAOstrinia scapulalispolypeptidenewscf_2583 247..5736 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA007257-RA:exon:3543OSCA007257-RA:exon:3543Ostrinia scapulalisexonnewscf_2583 247..354 +
OSCA007257-RA:exon:3544OSCA007257-RA:exon:3544Ostrinia scapulalisexonnewscf_2583 757..972 +
OSCA007257-RA:exon:3545OSCA007257-RA:exon:3545Ostrinia scapulalisexonnewscf_2583 3025..3114 +
OSCA007257-RA:exon:3546OSCA007257-RA:exon:3546Ostrinia scapulalisexonnewscf_2583 4945..5736 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA007257-RA:cdsOSCA007257-RA:cdsOstrinia scapulalisCDSnewscf_2583 4945..5736 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA007257-RA ID=OSCA007257-RA|Name=OSCA007257-RA|organism=Ostrinia scapulalis|type=mRNA|length=1206bp
ATGGAAACGATACGGGTTGACATCCAACGAGTACCTATTGAGTTGCTGAG
TTTGCTGCGGCGCTTCTTCTCAGCACTTGCCAAATATTGGTGTCGAAGCG
CTGGTAGGATCACTAATACCAACCACCCAGAATTTATAAATGTTTATTAT
GTGAACCATATTCACGTATATTTCTTGTTCCAGAACTCTCAGAGGCTTGG
AAGAGTCAGCCGGGCGGAGACCAAAGCGACTGCCATGGTCTTCATCATGA
TAATCGCCTTCACTGTAGCCTGGACACCCTACTCCCTGTTCGCTCTAATA
GAGCAATTTGCGACCGAGGGCATCATCTCGCCGGGAGCTGGCGTGATACC
CGCTCTAGTCGCCAAGAGCTCTATCTGCTACGACCCCCTAATATACGTCG
GCATGAATACACAATTCCGGCAATCAATCAAACGGATATTCGGGATGCAC
AGCAAAGGGAAGCANTCGCAAACGGAGAAAGGGTTCAACAACACCATGAT
GTCCCCAGCCCACAAGCTCTCCGTCAACAATGAGACCACACGGTACATCT
CCTCAGATAGCACCATATCGACCATTCCCAAGAAAATCAAGGATACCAAA
AGGATAATTTTTAGCGATAGTATTACTGAAGTCAACAACGAAAATAACCG
TCCCATTAGAGATGTTGAACTATGCACAATTAATGAAAACAGAACAGCAT
CTGATGGAGAAAGATCTGGAGAAACCACGTATGATGATGACAGTAACAGC
AACAGCCAGAAGAAACTTGAACTATTCGGCGAATCGTGTAAACTGTTCAA
CAAACGGTCGCCTGTGGTTACAATAATAGACACTGAACATTTAATATTTA
GTAAATATGGNAAAAACAAACACGCCGATAGTGGAGGCGTCAATAATGTT
TACGGAAATGAGGCTTACGAAGAACATTCCACGGATAAAACGCACGATGT
ATACAAAACTGGTAATGAAATAAAGACACATAAAACTATAAAACATAGTT
ACTCACTTGATCTTAGTGTTGTAGCTAATGAAAGTAAAGGCAGGAAGCTG
TCGATAGAAACTAAATTCGAGACATTGATACAGCCGAAAGGATTCTTTAA
AGATACTATAATAAGTAAGCTTTTTGAACCGGAGTCGAAGCAAGATGGCA
TAAAGAGTTACTTGTGTACGATTGACAAAGGCGATGGAAGTGACAACAAC
TTGTAG
back to top

spliced messenger RNA

>OSCA007257-RA ID=OSCA007257-RA|Name=OSCA007257-RA|organism=Ostrinia scapulalis|type=mRNA|length=1206bp|location=Sequence derived from alignment at newscf_2583:247..5736+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGAAACGATACGGGTTGACATCCAACGAGTACCTATTGAGTTGCTGAG
TTTGCTGCGGCGCTTCTTCTCAGCACTTGCCAAATATTGGTGTCGAAGCG
CTGGTAGGATCACTAATACCAACCACCCAGAATTTATAAATGTTTATTAT
GTGAACCATATTCACGTATATTTCTTGTTCCAGAACTCTCAGAGGCTTGG
AAGAGTCAGCCGGGCGGAGACCAAAGCGACTGCCATGGTCTTCATCATGA
TAATCGCCTTCACTGTAGCCTGGACACCCTACTCCCTGTTCGCTCTAATA
GAGCAATTTGCGACCGAGGGCATCATCTCGCCGGGAGCTGGCGTGATACC
CGCTCTAGTCGCCAAGAGCTCTATCTGCTACGACCCCCTAATATACGTCG
GCATGAATACACAATTCCGGCAATCAATCAAACGGATATTCGGGATGCAC
AGCAAAGGGAAGCAYTCGCAAACGGAGAAAGGGTTCAACAACACCATGAT
GTCCCCAGCCCACAAGCTCTCCGTCAACAATGAGACCACACGGTACATCT
CCTCAGATAGCACCATATCGACCATTCCCAAGAAAATCAAGGATACCAAA
AGGATAATTTTTAGCGATAGTATTACTGAAGTCAACAACGAAAATAACCG
TCCCATTAGAGATGTTGAACTATGCACAATTAATGAAAACAGAACAGCAT
CTGATGGAGAAAGATCTGGAGAAACCACGTATGATGATGACAGTAACAGC
AACAGCCAGAAGAAACTTGAACTATTCGGCGAATCGTGTAAACTGTTCAA
CAAACGGTCGCCTGTGGTTACAATAATAGACACTGAACATTTAATATTTA
GTAAATATGGWAAAAACAAACACGCCGATAGTGGAGGCGTCAATAATGTT
TACGGAAATGAGGCTTACGAAGAACATTCCACGGATAAAACGCACGATGT
ATACAAAACTGGTAATGAAATAAAGACACATAAAACTATAAAACATAGTT
ACTCACTTGATCTTAGTGTTGTAGCTAATGAAAGTAAAGGCAGGAAGCTG
TCGATAGAAACTAAATTCGAGACATTGATACAGCCGAAAGGATTCTTTAA
AGATACTATAATAAGTAAGCTTTTTGAACCGGAGTCGAAGCAAGATGGCA
TAAAGAGTTACTTGTGTACGATTGACAAAGGCGATGGAAGTGACAACAAC
TTGTAG
back to top

protein sequence of OSCA007257-RA

>OSCA007257-PA ID=OSCA007257-PA|Name=OSCA007257-RA|organism=Ostrinia scapulalis|type=polypeptide|length=401bp
METIRVDIQRVPIELLSLLRRFFSALAKYWCRSAGRITNTNHPEFINVYY
VNHIHVYFLFQNSQRLGRVSRAETKATAMVFIMIIAFTVAWTPYSLFALI
EQFATEGIISPGAGVIPALVAKSSICYDPLIYVGMNTQFRQSIKRIFGMH
SKGKXSQTEKGFNNTMMSPAHKLSVNNETTRYISSDSTISTIPKKIKDTK
RIIFSDSITEVNNENNRPIRDVELCTINENRTASDGERSGETTYDDDSNS
NSQKKLELFGESCKLFNKRSPVVTIIDTEHLIFSKYGKNKHADSGGVNNV
YGNEAYEEHSTDKTHDVYKTGNEIKTHKTIKHSYSLDLSVVANESKGRKL
SIETKFETLIQPKGFFKDTIISKLFEPESKQDGIKSYLCTIDKGDGSDNN
L
back to top

mRNA from alignment at newscf_2583:247..5736+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA007257-RA ID=OSCA007257-RA|Name=OSCA007257-RA|organism=Ostrinia scapulalis|type=mRNA|length=5490bp|location=Sequence derived from alignment at newscf_2583:247..5736+ (Ostrinia scapulalis)
ATGGAAACGATACGGGTTGACATCCAACGAGTACCTATTGAGTTGCTGAG TTTGCTGCGGCGCTTCTTCTCAGCACTTGCCAAATATTGGTGTCGAAGCG CTGGTAGGGTAAAAAGATTATGAGACAATAAATGTAGAGGCTCCTTAAGA GCATAATATTTGACGATTTGTAAGTAAGTATTTTGACTTTGATTTTGTAC CAGGCAGAATAGAAATATTAACCTTATTTTAATCGTGACTATAACCGTGA AGTTTTTTGTATGGAGTTTGACAGACTGTTGAAGTTTGTTAAAGTAAGAT GGTGCAACCCAGCCTTATTGTTTCATAGTCACTCATTATTCTTCTTAATA TGCAACTTGACGAATACGTAAGTAGGAGTAAATAAAATTTACCTAACTAC TGTGAGATGCGGGCAAGCCCCGCAATTTCAGAAAAAAAAAATATTTCTTG AATTTTTCGCGTCTGTCTCATAAGACAAGGGTGTACCTAGTTCTTTATTT ATTTGTTTAGATCACTAATACCAACCACCCAGAATTTATAAATGTTTATT ATGTGAACCATATTCACGTATATTTCTTGTTCCAGAACTCTCAGAGGCTT GGAAGAGTCAGCCGGGCGGAGACCAAAGCGACTGCCATGGTCTTCATCAT GATAATCGCCTTCACTGTAGCCTGGACACCCTACTCCCTGTTCGCTCTAA TAGAGCAATTTGCGACCGAGGGCATCGTAAGTGAATTTTAAAATTCGTAC AATATCCATAAATTAGAAAAGAAAATTGCACAAAATAATCCCTAGATAGA TGAAATATGAACTTGCTCTTATCAGAACCTTAGTCCTGAAATACTAGTAG GTACATAATGAAATTCTTTTCATAGTCATTTTAATACTTAACAAGTCTAT GACTTGATAACAATATATTAGGAAAGTTTCGCAATTTTACTTTAAAAATA AGTTACCTACTTATTTATTGCTTATTTTGGAATACTTATCGAACTTTGCT TGTCCATACTTTCAAAGATCTTTAATAACTTAAAGAGAATGGCTTAATAC TTGTAAGTTCTACTGCAAAAATAACTCTTATTGTGGATCGTGTAGAACAG TGTTTTTCAACCTGTGGTTTCGGAGTTCGAAGCCTCTAAAAGGGGGTCGC AAGAGGTCGTAAAACTACCTCCGTAAAAAAACATTAAAGTTAGGTATAAA TACGAGATATAATATAATCAATATAATCCGATTTATCCGAAATCTAATTA TGCAAATGCATAAGTGTTGTAGGATTGAAGTATTTGGTCCCTAAAAACAT CTTTGTAATAATAAAAAATGCATGAAAAAAAGCGAACGGTCGGGGGGTCG CAAATTTTTTTCCTACTAGAGGGGTCATGTCATGAAAAAGGTTGAAAACC ACTGGTGTAGAATAAGGGCTGTCCCAAGGTTATTAAATTTAAGTCAGATT AGACAAAGGTGACTGTGATTTCATTCGTTAATTAAAATATTGATTAACAA AATGCAAATTTTATTAGCATTGTAAATACTTCAAGATTGTGAACCAAAAG CCTGTTTATCATAAATCTCCATTATTTAATTACAAACAAAACTGATTCTC TGTCGAGCTGACGACTCCATACTATGGAGTCCATAGTTCCCATTAACGTT TTATGGCGCAATAACTTGAAACTCTCGCATCAGCTGTATTTTATAGTAAA TGTAACACTTAGGAAAGTTTGGGAAAACAACTGTTGCAGAATATTAACGT AAGCCATTTTTGATCGCTACTTTTCTAGTCCCATTAAAGATAGGTACTTT CTTTGTGACCTAAACATTAGTCTTACGATCAATGGTCTTGAGTTAGTTAA AATAAATAATCCTAAATACCTATATAGGTAATACGACGAATAAATCAAAG TACCTAATTATGTAAATTGTTATTTTGTAAAAATCAACCCCTAAGGGGAT TTAGTTGGGGTTCTATACTAGTACATATAGGTATACTGAAAAAATTACGC AGACGAAACAGCGGGAAAAAGCTAGTATAGAACCAAATCATACTTTATAA TTATGTTCTTCATATGCGTCACCTTCTATGTAAAATACAGATTAACTGTT TTGAATATGTTTGCTTTGCGCACACATACCGTTAATAATTATGCCCTTAC TTAAGTGCTGGTACGATCTTTGCTTTACTCCGTGTCTTAACTGGTATGTA ACTGAGTGAGAATAAACCATAGATTTGTTCTTCCAGAGAATTCGCAGACG AAAACAATTTATTCAACAATTTATTGTTGAATTAATAATTTTAATGAAGA GGCATTATTATTTAAATAGAAAATCTTTTCTTAGTACATTAAAACTTATA TTACTAGACTTAACTTTAACTTAAACAAACACTGCAATTAAGTTCTTTTG TGTATCTAAGCAGTAACTCAAAGTTGAGTTAATTACCATGAAATCTTTTT ACCTTGACCTATTTGACAACAGGCCAAGTGCAATCCAATTTTTGTTGGCG TCGACAACTCATTACCAGGATCTTAGTAATTTTGTTAACGAGTAATGTCC ATTCACTGGGATCATTATTATGCAATTATCTTGAAAACATAATTGCTTAT GTTTTCTTTATATTTACAAACAAAACCTCGCAAGCAAAAAGTTTTGCATT TCGAAATCCTCAGTCTCACATTATTTTTTTTTATATTTTAACAAAAAACG TCTAATTAAAACACACAATTACGTTATTCAAGTTTCGACCTTGAGTTTAC GATGATTAAATATCAATTTCCATTGCAGATCTCGCCGGGAGCTGGCGTGA TACCCGCTCTAGTCGCCAAGAGCTCTATCTGCTACGACCCCCTAATATAC GTCGGCATGAATACACAAGTAAGTACAATTTAATTAGATAAAATATATTA AGTACCAGTTTCTGTTTTGCACAGTTGACAGCACATCATACTTCACATTT TTGTTATAAAATGGCACTTCTTAAAAGTTTATAAGGTACTACAAACTTTA AGCTTGGTGTGCTGCTGTCGTCTGTACAATCACATTCTGATGTAGGTAAA TCTTAGTTTTCAGTCACAAGCATGTTTGTAACAACAAAACAGTACAGAAA ATAATAATAAAGTACCTACATCGTAATACCTATTTATTGAGGCAGAAAGT GTGTTGAAAACAGTACTTTAGTCTACGCTGAAAGAAACTGACCTACTGTT ACCTGCTGACTTACCTATTTATTGAATAAAAATGAAAGACTGGGCTAATC GCATAAGATTTACGTTAACCTACGTTATCTTTAGTAGCAATGTTATGGAA ACAGAGAGTTTAATCTCTGTTTGAGTAAATCTTTGTCATTTTATGTACAA TTGTACATACCTTCACTTCTAAAGCCGGGTCTCCAGCGCGTATTTACCCT ACACAATCAACAAAACATGTCAACATTCAACAAAATTGTCTGCAAATTGT GCGTTGACAAAGTTTTGCGTTCTATGTAACAATTCACGTCGYATGCGGAA TGCTGTTTAGATGATGCTAGGCGCTCGCAAATGGGTATTAGTAGACCGCA AATTGATGGCAGGGACATTCCCTAAAATGTACGCCAAACAAATGTTCTGA AACTAATCTGTAGACACATTCTCTATACAAATAAAAACGTTTGTTTTTAT TTGTATAGAGAACAATAGTGTCTAGACAAACCTAAAGAGGATTTAGGACG CTATTTGGATCAAATATGTAATTACTCAATAATGAATAATAAATAAATAA AATAAATTAATTAATTAATTAACCTGGCGTCACATGATGAATTCCATCAG TAGAGTTTAAACTTTTCATACCCTCATTAAWAAGGATTACAAACGCTGGT ATACCTACCTAATACTTTGTACAATACCTACTACCTACAGTCCTAAGTGA AAAAGTATAATTTCACCGTTTATTTAGGTTTCACATTAATATTTTTGATA AGTAAAAAAACAGTAAAAAAGGTAAAATTCTCGGAACTGGAATGAAAAAA CGCGAATACATCAGATGCTTCACGCTCTACTTATTCGACATTTGTACAAT GTTAATTCGATACAGTATAAAAGCACAATAAAAGCCCTGACAAACGAATT TTACAGCTGTATTGCCTATTGTAGAAGCAATGTTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAATC AACTTTTGAAAATTTTCATAGCCCTAATTTTGTGTGGTTTGTCCGCAGTT CCGGCAATCAATCAAACGGATATTCGGGATGCACAGCAAAGGGAAGCAYT CGCAAACGGAGAAAGGGTTCAACAACACCATGATGTCCCCAGCCCACAAG CTCTCCGTCAACAATGAGACCACACGGTACATCTCCTCAGATAGCACCAT ATCGACCATTCCCAAGAAAATCAAGGATACCAAAAGGATAATTTTTAGCG ATAGTATTACTGAAGTCAACAACGAAAATAACCGTCCCATTAGAGATGTT GAACTATGCACAATTAATGAAAACAGAACAGCATCTGATGGAGAAAGATC TGGAGAAACCACGTATGATGATGACAGTAACAGCAACAGCCAGAAGAAAC TTGAACTATTCGGCGAATCGTGTAAACTGTTCAACAAACGGTCGCCTGTG GTTACAATAATAGACACTGAACATTTAATATTTAGTAAATATGGWAAAAA CAAACACGCCGATAGTGGAGGCGTCAATAATGTTTACGGAAATGAGGCTT ACGAAGAACATTCCACGGATAAAACGCACGATGTATACAAAACTGGTAAT GAAATAAAGACACATAAAACTATAAAACATAGTTACTCACTTGATCTTAG TGTTGTAGCTAATGAAAGTAAAGGCAGGAAGCTGTCGATAGAAACTAAAT TCGAGACATTGATACAGCCGAAAGGATTCTTTAAAGATACTATAATAAGT AAGCTTTTTGAACCGGAGTCGAAGCAAGATGGCATAAAGAGTTACTTGTG TACGATTGACAAAGGCGATGGAAGTGACAACAACTTGTAG
back to top

Coding sequence (CDS) from alignment at newscf_2583:247..5736+

>OSCA007257-RA ID=OSCA007257-RA|Name=OSCA007257-RA|organism=Ostrinia scapulalis|type=CDS|length=1206bp|location=Sequence derived from alignment at newscf_2583:247..5736+ (Ostrinia scapulalis)
ATGGAAACGATACGGGTTGACATCCAACGAGTACCTATTGAGTTGCTGAG
TTTGCTGCGGCGCTTCTTCTCAGCACTTGCCAAATATTGGTGTCGAAGCG
CTGGTAGGATCACTAATACCAACCACCCAGAATTTATAAATGTTTATTAT
GTGAACCATATTCACGTATATTTCTTGTTCCAGAACTCTCAGAGGCTTGG
AAGAGTCAGCCGGGCGGAGACCAAAGCGACTGCCATGGTCTTCATCATGA
TAATCGCCTTCACTGTAGCCTGGACACCCTACTCCCTGTTCGCTCTAATA
GAGCAATTTGCGACCGAGGGCATCATCTCGCCGGGAGCTGGCGTGATACC
CGCTCTAGTCGCCAAGAGCTCTATCTGCTACGACCCCCTAATATACGTCG
GCATGAATACACAATTCCGGCAATCAATCAAACGGATATTCGGGATGCAC
AGCAAAGGGAAGCAYTCGCAAACGGAGAAAGGGTTCAACAACACCATGAT
GTCCCCAGCCCACAAGCTCTCCGTCAACAATGAGACCACACGGTACATCT
CCTCAGATAGCACCATATCGACCATTCCCAAGAAAATCAAGGATACCAAA
AGGATAATTTTTAGCGATAGTATTACTGAAGTCAACAACGAAAATAACCG
TCCCATTAGAGATGTTGAACTATGCACAATTAATGAAAACAGAACAGCAT
CTGATGGAGAAAGATCTGGAGAAACCACGTATGATGATGACAGTAACAGC
AACAGCCAGAAGAAACTTGAACTATTCGGCGAATCGTGTAAACTGTTCAA
CAAACGGTCGCCTGTGGTTACAATAATAGACACTGAACATTTAATATTTA
GTAAATATGGWAAAAACAAACACGCCGATAGTGGAGGCGTCAATAATGTT
TACGGAAATGAGGCTTACGAAGAACATTCCACGGATAAAACGCACGATGT
ATACAAAACTGGTAATGAAATAAAGACACATAAAACTATAAAACATAGTT
ACTCACTTGATCTTAGTGTTGTAGCTAATGAAAGTAAAGGCAGGAAGCTG
TCGATAGAAACTAAATTCGAGACATTGATACAGCCGAAAGGATTCTTTAA
AGATACTATAATAAGTAAGCTTTTTGAACCGGAGTCGAAGCAAGATGGCA
TAAAGAGTTACTTGTGTACGATTGACAAAGGCGATGGAAGTGACAACAAC
TTGTAG
back to top
Synonyms
The feature 'OSCA007257-RA' has the following synonyms
Synonym
maker-newscf_2583-augustus-gene-0.13-mRNA-1