OSCA011003-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA011003-RA
Unique NameOSCA011003-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1065
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2contignewscf_2:35530..45123 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.18
QI0|0|0|0.8|1|1|5|0|354
AED0.17
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA011003OSCA011003Ostrinia scapulalisgenenewscf_2 35530..45123 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011003-RAOSCA011003-PAOstrinia scapulalispolypeptidenewscf_2 35530..45123 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011003-RA:exon:21OSCA011003-RA:exon:21Ostrinia scapulalisexonnewscf_2 35530..35736 +
OSCA011003-RA:exon:22OSCA011003-RA:exon:22Ostrinia scapulalisexonnewscf_2 39979..40077 +
OSCA011003-RA:exon:23OSCA011003-RA:exon:23Ostrinia scapulalisexonnewscf_2 40686..40914 +
OSCA011003-RA:exon:24OSCA011003-RA:exon:24Ostrinia scapulalisexonnewscf_2 41378..41772 +
OSCA011003-RA:exon:25OSCA011003-RA:exon:25Ostrinia scapulalisexonnewscf_2 44989..45123 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011003-RA:cdsOSCA011003-RA:cdsOstrinia scapulalisCDSnewscf_2 44989..45123 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA011003-RA ID=OSCA011003-RA|Name=OSCA011003-RA|organism=Ostrinia scapulalis|type=mRNA|length=1065bp
AAAGGATGGTACCTACGGTACGGCAGTGTTTGCTTCGCGCTGGTCTTGGC
GGGGGCACTGCCGTGTCCCCCGGTAAAGTATTCTTTGCGCGGGAAGAGGA
AGGGTCAGGATGTGGGCACCACAGGACCGGTCGTCATGGAAATTGGGGGA
AGCCTTTGTCCAGCCGTGGACGTCGATTCGATTAAAAAGTGTAACTTGTC
TAAGGGGCAGCGAGCTAGAGGCGCGGTGGAGACCCCGGCGCTGCTGGTGC
GCTTGCAGCAGAAGCTGGCGCTGCTGGAGCAGTCGCACTCCGTCGCCGTC
AGAGAGGAGCAAATAAAAGCAAAACGCGCCGAAGAATCAGCTCGCAAGAT
CTGTGCCAGACAAGAGGAACGCGTGGCTTTACTCGAGAGNAAGCTTGCCG
AGCTATCCGAGACTGTAGGCGTGTATGACCTGAGGCGAAGAAGAGATCAA
CAGCTGATCCAGCAGTTGAAGGAGTCGTTGAATGGACGGCTGATGGACAA
GATTCAAGCTAATGAGTATGGGGATGGGGTGGAAGGCGAAACTACACCCA
AAAGTGAGACAGACAATGACAAACTAGCAGACAGCGAATATCTGCAAACA
CTAATCGACAAAATACACATCCTAAAGAAAGAATTGATCGCTGAAAACGA
AAAACTTGGCAGCCCCATCGACATATCCACAGTTTTCAAAGTAGACGGCT
ATGAGAATGCCCATTCAAAATGCAGAGAAGAATATGAAAAGTTGAGGACG
GAATTTGAAACATACAAAACTCTAAATTCAAAGCCTGTTTCAAGTGGGGA
TGACTCGCCGACTGAGATAGAAGATCTGAAGAGCGAGATAGAGGTATTAA
AGGAGAAAGTGGAGACTTACAAGATGATGTTGGATGAAGAAAAACAGGAC
AAAGTTGACACTTTGAAATTGTATGAAGAGGACGTGACAGCACCGCCGCA
TATGCTCCACTATGCGCACGAGTTGGCTCGCAAAGACCTCGACATATCGC
AGCTCAGGAAAGAGAAACACATTCTCGAGGGGCAATACAGGTATGGAACC
AGATTATTTTGTTAA
back to top

spliced messenger RNA

>OSCA011003-RA ID=OSCA011003-RA|Name=OSCA011003-RA|organism=Ostrinia scapulalis|type=mRNA|length=1065bp|location=Sequence derived from alignment at newscf_2:35530..45123+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
AAAGGATGGTACCTACGGTACGGCAGTGTTTGCTTCGCGCTGGTCTTGGC
GGGGGCACTGCCGTGTCCCCCGGTAAAGTATTCTTTGCGCGGGAAGAGGA
AGGGTCAGGATGTGGGCACCACAGGACCGGTCGTCATGGAAATTGGGGGA
AGCCTTTGTCCAGCCGTGGACGTCGATTCGATTAAAAAGTGTAACTTGTC
TAAGGGGCAGCGAGCTAGAGGCGCGGTGGAGACCCCGGCGCTGCTGGTGC
GCTTGCAGCAGAAGCTGGCGCTGCTGGAGCAGTCGCACTCCGTCGCCGTC
AGAGAGGAGCAAATAAAAGCAAAACGCGCCGAAGAATCAGCTCGCAAGAT
CTGTGCCAGACAAGAGGAACGCGTGGCTTTACTCGAGAGRAAGCTTGCCG
AGCTATCCGAGACTGTAGGCGTGTATGACCTGAGGCGAAGAAGAGATCAA
CAGCTGATCCAGCAGTTGAAGGAGTCGTTGAATGGACGGCTGATGGACAA
GATTCAAGCTAATGAGTATGGGGATGGGGTGGAAGGCGAAACTACACCCA
AAAGTGAGACAGACAATGACAAACTAGCAGACAGCGAATATCTGCAAACA
CTAATCGACAAAATACACATCCTAAAGAAAGAATTGATCGCTGAAAACGA
AAAACTTGGCAGCCCCATCGACATATCCACAGTTTTCAAAGTAGACGGCT
ATGAGAATGCCCATTCAAAATGCAGAGAAGAATATGAAAAGTTGAGGACG
GAATTTGAAACATACAAAACTCTAAATTCAAAGCCTGTTTCAAGTGGGGA
TGACTCGCCGACTGAGATAGAAGATCTGAAGAGCGAGATAGAGGTATTAA
AGGAGAAAGTGGAGACTTACAAGATGATGTTGGATGAAGAAAAACAGGAC
AAAGTTGACACTTTGAAATTGTATGAAGAGGACGTGACAGCACCGCCGCA
TATGCTCCACTATGCGCACGAGTTGGCTCGCAAAGACCTCGACATATCGC
AGCTCAGGAAAGAGAAACACATTCTCGAGGGGCAATACAGGTATGGAACC
AGATTATTTTGTTAA
back to top

protein sequence of OSCA011003-RA

>OSCA011003-PA ID=OSCA011003-PA|Name=OSCA011003-RA|organism=Ostrinia scapulalis|type=polypeptide|length=354bp
KGWYLRYGSVCFALVLAGALPCPPVKYSLRGKRKGQDVGTTGPVVMEIGG
SLCPAVDVDSIKKCNLSKGQRARGAVETPALLVRLQQKLALLEQSHSVAV
REEQIKAKRAEESARKICARQEERVALLEXKLAELSETVGVYDLRRRRDQ
QLIQQLKESLNGRLMDKIQANEYGDGVEGETTPKSETDNDKLADSEYLQT
LIDKIHILKKELIAENEKLGSPIDISTVFKVDGYENAHSKCREEYEKLRT
EFETYKTLNSKPVSSGDDSPTEIEDLKSEIEVLKEKVETYKMMLDEEKQD
KVDTLKLYEEDVTAPPHMLHYAHELARKDLDISQLRKEKHILEGQYRYGT
RLFC
back to top

mRNA from alignment at newscf_2:35530..45123+

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA011003-RA ID=OSCA011003-RA|Name=OSCA011003-RA|organism=Ostrinia scapulalis|type=mRNA|length=9594bp|location=Sequence derived from alignment at newscf_2:35530..45123+ (Ostrinia scapulalis)
AAAGGATGGTACCTACGGTACGGCAGTGTTTGCTTCGCGCTGGTCTTGGC GGGGGCACTGCCGTGTCCCCCGGTAAAGTATTCTTTGCGCGGGAAGAGGA AGGGTCAGGATGTGGGCACCACAGGACCGGTCGTCATGGAAATTGGGGGA AGCCTTTGTCCAGCCGTGGACGTCGATTCGATTAAAAAGTGTAACTTGTC TAAGGGGGTTGATCGCCATCGCCATCGTGCACGCCGGCTGAATGCTTTAG TTTGGCTTATACCTGTGTTTTAGGGGACGCGGCTCACGCGGCTCTTCCTA ATTATTTCAATAGGTTTTTTTAATGATATCGATATTTATTAGAATCGATT TCTTCTTAGGTACTCGATGTTTGGTAACATCCCTATGTGCTATGCACGCA ACGCACGTCACYTCACTAATGTACGTAAATGTCACAGATGGTAAATGTTA ATGTCATTTTTTATAGTTTTCATCAGGGTGTGGAAACTTCCATACAACGG TCATCGAAGTGAAACTTGCTTCCAANNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNTCAGAGAGGTGGGCACAGTGGGCTAGAGACACGCTAGC AGCGAGCTAGAGGCGCGGTGGAGACCCCGGCGCTGCTGGTGCGCTTGCAG CAGAAGCTGGCGCTGCTGGAGCAGTCGCACTCCGTCGCCGTCAGAGAGGT GGGCCACAGTGGGCTAGAGACAAGCTAAAGTCCGGTCGCCGAGCAGATAA AATTTCGTCCAATGACCCCAAGCTATCCATCCTTATCGCTCACGTGTGGC GGGCGGCCGCAGTGAGTGAGCGCGACAGCCTTTGGCGACCGGACTTTAGC ACCGAGCAGCTGGCTAGCTAGCCTAGAACCTTCTAAAACCTCATTATCTT AGCTCACCTTTGGAAGTCGTAATCATATTGTAGGAATTTAAGTACAATCC AGAAATGACTTCTAAAATTGAGTGGTTCGTAGTGAGATCAGGTACCGTAA AAGAACGAACGACGCGACAGTGCTGATCATTCTAATGTACCGGTTTCCAT TTGGTCTCAACAACAAATGTGTATAAGTTCCATCTAAAGGAATAATGCCT GTTTTCAGCATCAATGCCTAACTTTTATGTGACCCCTATGATAACATAAC AGGAATTTTGTTTTCATAGGGGTCACTTAACAATTACAGATTGATGGTGA AAACGGGCATAAGTGTCCACCTTTGGGTCCTCCCCACATTGCAGGATAAA TTCCTTCAGCAAAAATCTTGAAAAACCAAGCACTAACCTTAACTTAACAT CTCCAGGAGCAAATAAAAGCAAAACGCGCCGAAGAATCAGCTCGCAAGAT CTGTGCCAGACAAGAGGAACGCGTGGCTTTACTCGAGAGRAAGCTTGCCG AGCTATCCGAGACTGTAGGCGTGTATGACCTGAGGCGAAGAAGAGATCAA CAGCTGATCCAGCAGTTGAAGGAGTCGTTGAATGGACGGCTGATGGACAA GATTCAAGCTAATGAGTATGGGGATGGGGTGGAAGGTTGGTATTGTGTAT TTCTTTTGTTTTACTTAGTGGCTTTAGCTTTAGAGCAAGCTCGCTGAGAT ATCTGAGACTGGGTTTATTTTTTTTTATGCATGACAAGGCAAGTATTTGA CTGTAATCGCACCTGGTGTAAAGTGAGATGCAGTCTAGGATGATGCATAT CTGCCCTGTAAGTCCATATTCACTCACACATAGTATTCAGGAAAGACGGC AATATAAGTATAGTAATAATATGTTAACAATATGGTGCTATTTAGTTAGC CTCAGAGTTGAGTCCTCACCTCACCGTCAAAATGCAAAAAAACCTATTCA GTGATTGGTCACTGCTTGCTCGAGAATTCCTTGTGAGCAAGCTATTGATA TTGCGTTGTACCTGATGGAAAGTGTTAAAGCTTGTGCATTATTTGCGTAT TTGTCTTGCTACCCAATACTATGTTAATGTATGTTCGTATGCTTTCAGGC GAAACTACACCCAAAAGTGAGACAGACAATGACAAACTAGCAGACAGCGA ATATCTGCAAACACTAATCGACAAAATACACATCCTAAAGAAAGAATTGA TCGCTGAAAACGAAAAACTTGGCAGCCCCATCGACATATCCACAGTTTTC AAAGTAGACGGCTATGAGAATGCCCATTCAAAATGCAGAGAAGAATATGA AAAGTTGAGGACGGAATTTGAAACATACAAAACTCTAAATTCAAAGCCTG TTTCAAGTGGGGATGACTCGCCGACTGAGATAGAAGATCTGAAGAGCGAG ATAGAGGTATTAAAGGAGAAAGTGGAGACTTACAAGATGATGTTGGATGA AGAAAAACAGGACAAAGTTGACACTTTGAAATTGTATGAAGAGGTATGCC AAGTTATTCAAGTTGAATTTTTATTAAGAGTGGTTTTGCCTAAAAGTATA ATTCTGGGGGTCTGATGCCCGTTTGTTTTCACCATCAATCCCTAATTTTT AAGTGANCGCCATCAGAGAGGTGGGCACAGTGGGCTAGAGACACGCTAGT CCGGTCGCAGAGCAGATAGGATTTCGTCCGATGACCCCAAGCTACCCATC CTTATCGCTCACGTGTGGCGGGCGGCCGCAGTGAGTGAGCGCGACAGCCT TTGGCGACCGGACTTTAGCACCAAGCAGCTGGCTAGCTAGCCTAGAACCT TCTAAAACCTCATCATTTTAGTTCATCGGTACCTTTGGAAGTCATAATCA TATTGTAGGAATTGAAGTACAGTCCAGAAATGACTTTTTAAAATTGAGTA GTTTGTAGTGAGATCAGGTACCGTATAAGAACGAACAAGGCTTTTATAAC AACAGTATAATTCAAATAATGAACTAATGTACTGGTTTCCATTTTGCCTC AACAATCAAGGAGTATAAGTTTCCATATAAAGGAATAAGTTCCACTTTAA GATCCTTCCTACTTTTAGAGATATCATATCCCTCCGGAACAGTGGTTCTT AACCTTTAAGTCACGAGGGACCATTTTACCAAATTTCTGTCTTGTCAGGG ACCACTTTTATTTTTTCAAAATCCTATGAAAGGGGAGGTCGATTTCTCAA CCGATTTCTCGCCCAGTGGTGCGCCGTTTGCGTTGTGTTGACTGGACTCA TCACGTCACCTCACTTGTTTAATACGATGTCTTCGTGGACCACTTGGAAT GCCTCCAGGGACCACCAGTGGTCCGCGGACCACCGGTTANNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA TAGTATCTAGTTATCTGAATCGAGTTAGTGAATTGATTTATATTTGTTTG TTTTCACAGGACGTGACAGCACCGCCGCATATGCTCCACTATGCGCACGA GTTGGCTCGCAAAGACCTCGACATATCGCAGCTCAGGAAAGAGAAACACA TTCTCGAGGGGCAATACAGGTATGGAACCAGATTATTTTGTTAA
back to top

Coding sequence (CDS) from alignment at newscf_2:35530..45123+

>OSCA011003-RA ID=OSCA011003-RA|Name=OSCA011003-RA|organism=Ostrinia scapulalis|type=CDS|length=1065bp|location=Sequence derived from alignment at newscf_2:35530..45123+ (Ostrinia scapulalis)
AAAGGATGGTACCTACGGTACGGCAGTGTTTGCTTCGCGCTGGTCTTGGC
GGGGGCACTGCCGTGTCCCCCGGTAAAGTATTCTTTGCGCGGGAAGAGGA
AGGGTCAGGATGTGGGCACCACAGGACCGGTCGTCATGGAAATTGGGGGA
AGCCTTTGTCCAGCCGTGGACGTCGATTCGATTAAAAAGTGTAACTTGTC
TAAGGGGCAGCGAGCTAGAGGCGCGGTGGAGACCCCGGCGCTGCTGGTGC
GCTTGCAGCAGAAGCTGGCGCTGCTGGAGCAGTCGCACTCCGTCGCCGTC
AGAGAGGAGCAAATAAAAGCAAAACGCGCCGAAGAATCAGCTCGCAAGAT
CTGTGCCAGACAAGAGGAACGCGTGGCTTTACTCGAGAGRAAGCTTGCCG
AGCTATCCGAGACTGTAGGCGTGTATGACCTGAGGCGAAGAAGAGATCAA
CAGCTGATCCAGCAGTTGAAGGAGTCGTTGAATGGACGGCTGATGGACAA
GATTCAAGCTAATGAGTATGGGGATGGGGTGGAAGGCGAAACTACACCCA
AAAGTGAGACAGACAATGACAAACTAGCAGACAGCGAATATCTGCAAACA
CTAATCGACAAAATACACATCCTAAAGAAAGAATTGATCGCTGAAAACGA
AAAACTTGGCAGCCCCATCGACATATCCACAGTTTTCAAAGTAGACGGCT
ATGAGAATGCCCATTCAAAATGCAGAGAAGAATATGAAAAGTTGAGGACG
GAATTTGAAACATACAAAACTCTAAATTCAAAGCCTGTTTCAAGTGGGGA
TGACTCGCCGACTGAGATAGAAGATCTGAAGAGCGAGATAGAGGTATTAA
AGGAGAAAGTGGAGACTTACAAGATGATGTTGGATGAAGAAAAACAGGAC
AAAGTTGACACTTTGAAATTGTATGAAGAGGACGTGACAGCACCGCCGCA
TATGCTCCACTATGCGCACGAGTTGGCTCGCAAAGACCTCGACATATCGC
AGCTCAGGAAAGAGAAACACATTCTCGAGGGGCAATACAGGTATGGAACC
AGATTATTTTGTTAA
back to top
Synonyms
The feature 'OSCA011003-RA' has the following synonyms
Synonym
maker-newscf_2-augustus-gene-0.9-mRNA-1