OSCA012500-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA012500-RA
Unique NameOSCA012500-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1986
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_14327contignewscf_14327:282..4321 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.16
QI0|0.16|0.07|1|0.75|0.76|13|0|662
AED0.11
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA012500OSCA012500Ostrinia scapulalisgenenewscf_14327 282..4321 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012500-RAOSCA012500-PAOstrinia scapulalispolypeptidenewscf_14327 282..4321 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012500-RA:cdsOSCA012500-RA:cdsOstrinia scapulalisCDSnewscf_14327 282..524 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012500-RA:exon:2596OSCA012500-RA:exon:2596Ostrinia scapulalisexonnewscf_14327 282..524 -
OSCA012500-RA:exon:2597OSCA012500-RA:exon:2597Ostrinia scapulalisexonnewscf_14327 599..667 -
OSCA012500-RA:exon:2598OSCA012500-RA:exon:2598Ostrinia scapulalisexonnewscf_14327 748..918 -
OSCA012500-RA:exon:2599OSCA012500-RA:exon:2599Ostrinia scapulalisexonnewscf_14327 1003..1115 -
OSCA012500-RA:exon:2600OSCA012500-RA:exon:2600Ostrinia scapulalisexonnewscf_14327 1477..1725 -
OSCA012500-RA:exon:2601OSCA012500-RA:exon:2601Ostrinia scapulalisexonnewscf_14327 2287..2508 -
OSCA012500-RA:exon:2602OSCA012500-RA:exon:2602Ostrinia scapulalisexonnewscf_14327 2696..2801 -
OSCA012500-RA:exon:2603OSCA012500-RA:exon:2603Ostrinia scapulalisexonnewscf_14327 2885..3012 -
OSCA012500-RA:exon:2604OSCA012500-RA:exon:2604Ostrinia scapulalisexonnewscf_14327 3103..3242 -
OSCA012500-RA:exon:2605OSCA012500-RA:exon:2605Ostrinia scapulalisexonnewscf_14327 3329..3417 -
OSCA012500-RA:exon:2606OSCA012500-RA:exon:2606Ostrinia scapulalisexonnewscf_14327 3502..3683 -
OSCA012500-RA:exon:2607OSCA012500-RA:exon:2607Ostrinia scapulalisexonnewscf_14327 3838..3961 -
OSCA012500-RA:exon:2608OSCA012500-RA:exon:2608Ostrinia scapulalisexonnewscf_14327 4172..4321 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA012500-RA ID=OSCA012500-RA|Name=OSCA012500-RA|organism=Ostrinia scapulalis|type=mRNA|length=1986bp
TCATACAAACTGAGTGACAATAATAATGGTCAGATCCCGTGGGCGGGCGG
CGGCGAGCGCGTGTACGCGGCCGTGGGCGGCGCGTGCCTGCTGCACCGCG
CCGGCGAGCTCAGCGTCGTCGAGTATGGACTGGATAGGGTGCTGCACACG
GTGCGCACGGAGCGCGTGAACCCGCACGTTCTGAGCGTGCGCATTAACGA
GGGCGGGGACACGCGCAAGCACTTGGCCTACTTATTGGACCGTCAAACCA
TCGCCGTGGTCGATCTAACCACAGTTGTAAAATTTTTTGGAGCAATTGAC
CTGGTTGAATTTAATTCTAAAATAGGTGTCCAATTGGGCCAGTGGTGGCA
NGAAGCACGCGTTGACTGGCTAGAGCTGAATGAAACCGGTCAGCTACTGC
TATTGCGCGATACGCGCCGTAGACTTGCGCTATTGCGGCTTGAAACTGGA
GATAAGGAAATAATAGCGAGTGGAGTAGGATTCGTGCAGTGGATAGAGAA
CTGCGACGCGGTTGTAGCGCAAACTCCCACACATCTGTTGATTTGGTACA
GTGTATGGGAAGCGGATAGCGCAGAGATGGCTGAATGTAGCGGCGGCGTA
GCGGTGGAAGTTAATGCACGTCGCGTACTATTCGAGGGCGGACAAGTGCC
GTACTTGCAATTGGATGAACATCGTCTAGCATTCAATAACGCGTTGCGTA
GTGGTGATCTGGCTGGTTGTGCAAAATATCTCGATGGAGTTGGAAATAAT
GCCGACGTGTCATCGTTGTGGAGGCAGCTAGCTGAACGGGCTCTGGCTAC
TGATGACATTCAACTGGCAGCAAAATGTTACCGAGAAGTAGGCGACGAAG
CACGAATGTTCTATCTGGACAAGACTGTAGAACTAGCCGCATCTGTTGGG
GATGGTGATGTGACTACAGGTTTAAATGTAGCTACAGTGCGCGCTCGCCT
ATCCATATTCGCGGGAGACCTACCGTCTGCGGAAGAGTGGTACGTGAAGA
AAGCCGGGAAGCCAGAGCTAGCCATCGACATGTACAAGCAGTTCAACCGG
TGGGCCGAGGCCGTGGCTCTGGCCGAGAAGACTGATCGCGCTGCTGTGGC
GATGCTGAAACAGCAGCATATGGACTACTTGACTTCTACTGGTCGCCTAG
GCGAAGCGGGGGCAGCACTAGCCTCATCAGGTGACGTGCAAGGCGCGGTG
CGGTTATGGCTTCGCGGCGGGCGCGCGCGCAGAGCCGCTGCGCTGTTGCT
GCAACATGCTTCGCTGCTGNGCGGTGCGGCTATGGCTGCGCGGCGGGCGC
GCGCGCAGAGCCGCTGCGCTGTTGCTGCAACATGCTTCGCTGCTGCGGGA
TACGGAACTGGTGGATGCTGTACATACGCAACTTGTGCAGAATGGTGGGA
GATGGCCGGAGAAATATCAGAGAGAAGAGGAGACAGCCGAACTGCTGTTG
AATATTACGCCAAAGGGAACAACTTCGCCAGAGCTGTTCAACTTGCTAGA
GAGGCTTGTCCAGCTGAGGTGACTAGCTTGGAAGGTATGTGGGGCTCCTG
GCTGGTGAGCTCCCGCCAGGCGGGCGCTGCAGTCCCGCATCTGATCGAAG
CTGGAGACACGAGAGGTGCTTTAGCTGCGGCGCTGAAAGCACATCACTAT
AGGAAGGCTTTGCAGATTGTTCAGGTTATCGAAGACAAAGAATCCATTCG
TGAGCAATGTGAGCAACTGGGTGATCATTTCATATCAACACAAGAATGGG
AGACGGCAGAACGAGTATTAAGTTCATGTGGGATGGCCGAGCGTGGCGTA
CGCGCATACAACACTGCAGGTCGTGTGGCCGACGGATTACGGCTTGCGGC
TCAACATCTTACTGAAGAAGAAACCAGGGATATTTATTTGCCACTGGCCC
AGCAAATGAGGGAGGATGGCCAACTACGGAAAGCGGAACAGATTTACATC
GGTCTCGGGGAGCCTGATGAGGCTATTTCTATGTAC
back to top

spliced messenger RNA

>OSCA012500-RA ID=OSCA012500-RA|Name=OSCA012500-RA|organism=Ostrinia scapulalis|type=mRNA|length=1986bp|location=Sequence derived from alignment at newscf_14327:282..4321- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
TCATACAAACTGAGTGACAATAATAATGGTCAGATCCCGTGGGCGGGCGG
CGGCGAGCGCGTGTACGCGGCCGTGGGCGGCGCGTGCCTGCTGCACCGCG
CCGGCGAGCTCAGCGTCGTCGAGTATGGACTGGATAGGGTGCTGCACACG
GTGCGCACGGAGCGCGTGAACCCGCACGTTCTGAGCGTGCGCATTAACGA
GGGCGGGGACACGCGCAAGCACTTGGCCTACTTATTGGACCGTCAAACCA
TCGCCGTGGTCGATCTAACCACAGTTGTAAAATTTTTTGGAGCAATTGAC
CTGGTTGAATTTAATTCTAAAATAGGTGTCCAATTGGGCCAGTGGTGGCA
YGAAGCACGCGTTGACTGGCTAGAGCTGAATGAAACCGGTCAGCTACTGC
TATTGCGCGATACGCGCCGTAGACTTGCGCTATTGCGGCTTGAAACTGGA
GATAAGGAAATAATAGCGAGTGGAGTAGGATTCGTGCAGTGGATAGAGAA
CTGCGACGCGGTTGTAGCGCAAACTCCCACACATCTGTTGATTTGGTACA
GTGTATGGGAAGCGGATAGCGCAGAGATGGCTGAATGTAGCGGCGGCGTA
GCGGTGGAAGTTAATGCACGTCGCGTACTATTCGAGGGCGGACAAGTGCC
GTACTTGCAATTGGATGAACATCGTCTAGCATTCAATAACGCGTTGCGTA
GTGGTGATCTGGCTGGTTGTGCAAAATATCTCGATGGAGTTGGAAATAAT
GCCGACGTGTCATCGTTGTGGAGGCAGCTAGCTGAACGGGCTCTGGCTAC
TGATGACATTCAACTGGCAGCAAAATGTTACCGAGAAGTAGGCGACGAAG
CACGAATGTTCTATCTGGACAAGACTGTAGAACTAGCCGCATCTGTTGGG
GATGGTGATGTGACTACAGGTTTAAATGTAGCTACAGTGCGCGCTCGCCT
ATCCATATTCGCGGGAGACCTACCGTCTGCGGAAGAGTGGTACGTGAAGA
AAGCCGGGAAGCCAGAGCTAGCCATCGACATGTACAAGCAGTTCAACCGG
TGGGCCGAGGCCGTGGCTCTGGCCGAGAAGACTGATCGCGCTGCTGTGGC
GATGCTGAAACAGCAGCATATGGACTACTTGACTTCTACTGGTCGCCTAG
GCGAAGCGGGGGCAGCACTAGCCTCATCAGGTGACGTGCAAGGCGCGGTG
CGGTTATGGCTTCGCGGCGGGCGCGCGCGCAGAGCCGCTGCGCTGTTGCT
GCAACATGCTTCGCTGCTGNGCGGTGCGGCTATGGCTGCGCGGCGGGCGC
GCGCGCAGAGCCGCTGCGCTGTTGCTGCAACATGCTTCGCTGCTGCGGGA
TACGGAACTGGTGGATGCTGTACATACGCAACTTGTGCAGAATGGTGGGA
GATGGCCGGAGAAATATCAGAGAGAAGAGGAGACAGCCGAACTGCTGTTG
AATATTACGCCAAAGGGAACAACTTCGCCAGAGCTGTTCAACTTGCTAGA
GAGGCTTGTCCAGCTGAGGTGACTAGCTTGGAAGGTATGTGGGGCTCCTG
GCTGGTGAGCTCCCGCCAGGCGGGCGCTGCAGTCCCGCATCTGATCGAAG
CTGGAGACACGAGAGGTGCTTTAGCTGCGGCGCTGAAAGCACATCACTAT
AGGAAGGCTTTGCAGATTGTTCAGGTTATCGAAGACAAAGAATCCATTCG
TGAGCAATGTGAGCAACTGGGTGATCATTTCATATCAACACAAGAATGGG
AGACGGCAGAACGAGTATTAAGTTCATGTGGGATGGCCGAGCGTGGCGTA
CGCGCATACAACACTGCAGGTCGTGTGGCCGACGGATTACGGCTTGCGGC
TCAACATCTTACTGAAGAAGAAACCAGGGATATTTATTTGCCACTGGCCC
AGCAAATGAGGGAGGATGGCCAACTACGGAAAGCGGAACAGATTTACATC
GGTCTCGGGGAGCCTGATGAGGCTATTTCTATGTAC
back to top

protein sequence of OSCA012500-RA

>OSCA012500-PA ID=OSCA012500-PA|Name=OSCA012500-RA|organism=Ostrinia scapulalis|type=polypeptide|length=662bp
SYKLSDNNNGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHT
VRTERVNPHVLSVRINEGGDTRKHLAYLLDRQTIAVVDLTTVVKFFGAID
LVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETG
DKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGV
AVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNN
ADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVG
DGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNR
WAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAV
RLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAG
YGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAR
EACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHY
RKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGV
RAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYI
GLGEPDEAISMY
back to top

mRNA from alignment at newscf_14327:282..4321-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA012500-RA ID=OSCA012500-RA|Name=OSCA012500-RA|organism=Ostrinia scapulalis|type=mRNA|length=4040bp|location=Sequence derived from alignment at newscf_14327:282..4321- (Ostrinia scapulalis)
TCATACAAACTGAGTGACAATAATAATGGTCAGATCCCGTGGGCGGGCGG CGGCGAGCGCGTGTACGCGGCCGTGGGCGGCGCGTGCCTGCTGCACCGCG CCGGCGAGCTCAGCGTCGTCGAGTATGGACTGGATAGGGTGCTGCACACG GTTAGTCTTCAACACATCCCGCCAAGTAGGAATACAATTGTTTCTTTTTG TTTCCATGTACATAATGGAAAATAATGAATTCAGAAGGTTCTTTGAGCTG ATTTTGATGGTTCTGAATAAATTCTGATACCAATCCTGGCTTGCCAAATC TGTATCAAGCCGAAAAGGTTATGATTTATCTTTATACAATTTCTTCCATG GTGACTCTAGGTGCGCACGGAGCGCGTGAACCCGCACGTTCTGAGCGTGC GCATTAACGAGGGCGGGGACACGCGCAAGCACTTGGCCTACTTATTGGAC CGTCAAACCATCGCCGTGGTCGATCTAACCACAGGTGAGTGGGCTTGAAA CAGCTTTCGCAAACTTTATACTAGGTTTCACAGTTTTGTCGTATGGTATG CAACTGGTAGCCATCGAGATAATCGTGAAAATGGTTAGAAGGCTATCACT CTCCACTCTGTAGTATTAATGTTTTATTATGTACTTAGTTGTAAAATTTT TTGGAGCAATTGACCTGGTTGAATTTAATTCTAAAATAGGTGTCCAATTG GGCCAGTGGTGGCAYGAAGCACGCGTTGACTGGCTAGAGCTGAATGAAAC CGGTCAGCTACTGCTATTGCGCGATACGCGCCGTAGACTTGCGCTATTGC GGCTTGAAACTGGAGATAAGGTACTTAATTTAAAACTTATCACATTTGAC AGTTGCATTGCCTATGTAGTAGCATTTGCCGTAAATTGAAATAAATACTT ACAGGAAATAATAGCGAGTGGAGTAGGATTCGTGCAGTGGATAGAGAACT GCGACGCGGTTGTAGCGCAAACTCCCACACATCTGTTGATTTGGTAACAT TGCCCTTATAAATTATTAATACTCAGGTACGTATACCTGTTAAAAAAAAT GAGATTTAGTAACAGGATTTATTGTACAGGTACAGTGTATGGGAAGCGGA TAGCGCAGAGATGGCTGAATGTAGCGGCGGCGTAGCGGTGGAAGTTAATG CACGTCGCGTACTATTCGAGGGCGGACAAGTGCCGTACTTGCAATTGGAT GAACATCGTCTAGCATTCAGTACGTACTTTACCAGTACTTAAAAGTAAGG CAAACACATCAGGTAAGATCCGTCTTACCTATTGCCTATGTGCATTTATA TTGTTCCAGATAACGCGTTGCGTAGTGGTGATCTGGCTGGTTGTGCAAAA TATCTCGATGGAGTTGGAAATAATGCCGACGTGTCATCGTTGTGGAGGCA GCTAGCTGAACGGGCTCTGGCTACTGATGACATTCAAGTAAGAACTACAT AATAGATTTATCTTTAAGAAGGTAAATAGAGCGTTAATTTGGAATAAAAA TGTTAACTGATTAATTGCAGCTGGCAGCAAAATGTTACCGAGAAGTAGGC GACGAAGCACGAATGTTCTATCTGGACAAGACTGTAGAACTAGCCGCATC TGTTGGGGATGGTGATGTGACTACAGGTAAGAGATATTTCGCAAGTAACA ATACCGTAGATTCTATCATTATCTTGATGCTCGTAACTTGGAGTTTGTCT TTTCTTTCTTTTTCATAAGTCTGATTGATGGTTTCAATCTTTTAGGTTTC TTAGTGTTTGCTATTCTGTATTTGTATCCTATAAATTATTAACATATTAT TCATGTACCGTAGGTTTAAATGTAGCTACAGTGCGCGCTCGCCTATCCAT ATTCGCGGGAGACCTACCGTCTGCGGAAGAGTGGTACGTGAAGAAAGCCG GGAAGCCAGAGCTAGCCATCGACATGTACAAGCAGTTCAACCGGTGGGCC GAGGCCGTGGCTCTGGCCGAGAAGACTGATCGCGCTGCTGTGGCGATGCT GAAACAGCAGCATATGGACTACTTGACTTCTACTGGTTAGTATTTTTCAA GAGTATATATTATAGTCTTCGATCATCCTTGCATTAGCAGCATAACGGCC TTTGACCATCCAGTACTAACGTAACATAAGGTTTCTCCCATTTTTTCATC AGCCATCTTCTGGAGGTCGTCAGCCATCGAATAGACCCTACACTACGTTT GCGTGACATATGGTTTCCATCAGTTTCCATTTGAAAACCTGTTCGCACCT TTCACGGATTCTATATTCAGTCAATTTGAAGCATTATTTAGCAGTTGTTT TAGCTCTGCAGTGCGATTCTATAAACCTTCACCTAGACATCGCAACTAAA TCCGCGGTGAATTTTTAGATTAGCATTCTAAAAACTCTATCGTCGGCACG AATTTACTCTAGCGCTACGCTTGTCGGCGCGGCAGCGGGTTGAAAGAACT ACTGGATGTAGCATTAAAAAGAAAATTTAGAGTCATCAGAGAGACATTTT ATATGTATAATCGTGAACCCATCGTGAACCCCTATAGCTGAAATGATGAT GATGATGATGAATCGTGAGTCCACAAAAAGATTACGTTTTCTAAAGGTCG CCTAGGCGAAGCGGGGGCAGCACTAGCCTCATCAGGTGACGTGCAAGGCG CGGTGCGGTTATGGCTTCGCGGCGGGCGCGCGCGCAGAGCCGCTGCGCTG TTGCTGCAACATGCTTCGCTGCTGNGCGGTGCGGCTATGGCTGCGCGGCG GGCGCGCGCGCAGAGCCGCTGCGCTGTTGCTGCAACATGCTTCGCTGCTG CGGGATACGGAACTGGTGGATGCTGTACATACGCAACTTGTGCAGGTAGA TGCAGAAGGGTTGCCACCGGATTTTGGATTTTATTGTGAAGATGCAAGGT TCAAAAAGCCTCGCTACATCTCTGCTGCATGACATTGAGCTGTGTGTGTA CACGTAGCTTCTGGAGGTCCATTCAGGGATGGTCCGAGGTTCACGGATTT TGAATTTTAAAGTAATGAAATAAGTTTCAAAATCAATATTTTTCTCGATT TAAATGCGTGTTGACGATACTACGACGCATATGTGTGACATTTAGACTGA CGAAGGCTTGTTAGACCCGCGGACTTTCCAAAACTAAAAGATTTTCTTGT TAATTTTCTCTCTATTCACTTCAATCACTCAAAATTCACTATTATTTTAT AGGAAGAATGGTGGGAGATGGCCGGAGAAATATCAGAGAGAAGAGGAGAC AGCCGAACTGCTGTTGAATATTACGCCAAAGGGAACAACTTCGCCAGAGC TGTTCAACTTGCTAGAGAGGTAACTGTACCTACTTACTGAAGTGCTATTT AAAGATCTCGATAGTATACTGACTTAATAGATTTCTCTTACTTGTTTGTA AAGGCTTGTCCAGCTGAGGTGACTAGCTTGGAAGGTATGTGGGGCTCCTG GCTGGTGAGCTCCCGCCAGGCGGGCGCTGCAGTCCCGCATCTGATCGAAG CTGGAGACACGAGAGGTGCTTTAGCTGCGGCGCTGAAAGCACATCACTAT AGGAAGGCTTTGCAGATTGTTCAGGTAACTTTTTATTGTAATTTAACTTT TATGCCTATGTTGATAAAGAGTTTCTAACATTGCAATTATTTTTCTTGTT TCAGGTTATCGAAGACAAAGAATCCATTCGTGAGCAATGTGAGCAACTGG GTGATCATTTCATATCAACACAAGTAAACCATTTTACTGTTTCCTAGATT TGTTCTCTTTAACAAAACCAGATTTTTATTGGTATTTTTTTACCAAGGAA TGGGAGACGGCAGAACGAGTATTAAGTTCATGTGGGATGGCCGAGCGTGG CGTACGCGCATACAACACTGCAGGTCGTGTGGCCGACGGATTACGGCTTG CGGCTCAACATCTTACTGAAGAAGAAACCAGGGATATTTATTTGCCACTG GCCCAGCAAATGAGGGAGGATGGCCAACTACGGAAAGCGGAACAGATTTA CATCGGTCTCGGGGAGCCTGATGAGGCTATTTCTATGTAC
back to top

Coding sequence (CDS) from alignment at newscf_14327:282..4321-

>OSCA012500-RA ID=OSCA012500-RA|Name=OSCA012500-RA|organism=Ostrinia scapulalis|type=CDS|length=1986bp|location=Sequence derived from alignment at newscf_14327:282..4321- (Ostrinia scapulalis)
TCATACAAACTGAGTGACAATAATAATGGTCAGATCCCGTGGGCGGGCGG
CGGCGAGCGCGTGTACGCGGCCGTGGGCGGCGCGTGCCTGCTGCACCGCG
CCGGCGAGCTCAGCGTCGTCGAGTATGGACTGGATAGGGTGCTGCACACG
GTGCGCACGGAGCGCGTGAACCCGCACGTTCTGAGCGTGCGCATTAACGA
GGGCGGGGACACGCGCAAGCACTTGGCCTACTTATTGGACCGTCAAACCA
TCGCCGTGGTCGATCTAACCACAGTTGTAAAATTTTTTGGAGCAATTGAC
CTGGTTGAATTTAATTCTAAAATAGGTGTCCAATTGGGCCAGTGGTGGCA
YGAAGCACGCGTTGACTGGCTAGAGCTGAATGAAACCGGTCAGCTACTGC
TATTGCGCGATACGCGCCGTAGACTTGCGCTATTGCGGCTTGAAACTGGA
GATAAGGAAATAATAGCGAGTGGAGTAGGATTCGTGCAGTGGATAGAGAA
CTGCGACGCGGTTGTAGCGCAAACTCCCACACATCTGTTGATTTGGTACA
GTGTATGGGAAGCGGATAGCGCAGAGATGGCTGAATGTAGCGGCGGCGTA
GCGGTGGAAGTTAATGCACGTCGCGTACTATTCGAGGGCGGACAAGTGCC
GTACTTGCAATTGGATGAACATCGTCTAGCATTCAATAACGCGTTGCGTA
GTGGTGATCTGGCTGGTTGTGCAAAATATCTCGATGGAGTTGGAAATAAT
GCCGACGTGTCATCGTTGTGGAGGCAGCTAGCTGAACGGGCTCTGGCTAC
TGATGACATTCAACTGGCAGCAAAATGTTACCGAGAAGTAGGCGACGAAG
CACGAATGTTCTATCTGGACAAGACTGTAGAACTAGCCGCATCTGTTGGG
GATGGTGATGTGACTACAGGTTTAAATGTAGCTACAGTGCGCGCTCGCCT
ATCCATATTCGCGGGAGACCTACCGTCTGCGGAAGAGTGGTACGTGAAGA
AAGCCGGGAAGCCAGAGCTAGCCATCGACATGTACAAGCAGTTCAACCGG
TGGGCCGAGGCCGTGGCTCTGGCCGAGAAGACTGATCGCGCTGCTGTGGC
GATGCTGAAACAGCAGCATATGGACTACTTGACTTCTACTGGTCGCCTAG
GCGAAGCGGGGGCAGCACTAGCCTCATCAGGTGACGTGCAAGGCGCGGTG
CGGTTATGGCTTCGCGGCGGGCGCGCGCGCAGAGCCGCTGCGCTGTTGCT
GCAACATGCTTCGCTGCTGNGCGGTGCGGCTATGGCTGCGCGGCGGGCGC
GCGCGCAGAGCCGCTGCGCTGTTGCTGCAACATGCTTCGCTGCTGCGGGA
TACGGAACTGGTGGATGCTGTACATACGCAACTTGTGCAGAATGGTGGGA
GATGGCCGGAGAAATATCAGAGAGAAGAGGAGACAGCCGAACTGCTGTTG
AATATTACGCCAAAGGGAACAACTTCGCCAGAGCTGTTCAACTTGCTAGA
GAGGCTTGTCCAGCTGAGGTGACTAGCTTGGAAGGTATGTGGGGCTCCTG
GCTGGTGAGCTCCCGCCAGGCGGGCGCTGCAGTCCCGCATCTGATCGAAG
CTGGAGACACGAGAGGTGCTTTAGCTGCGGCGCTGAAAGCACATCACTAT
AGGAAGGCTTTGCAGATTGTTCAGGTTATCGAAGACAAAGAATCCATTCG
TGAGCAATGTGAGCAACTGGGTGATCATTTCATATCAACACAAGAATGGG
AGACGGCAGAACGAGTATTAAGTTCATGTGGGATGGCCGAGCGTGGCGTA
CGCGCATACAACACTGCAGGTCGTGTGGCCGACGGATTACGGCTTGCGGC
TCAACATCTTACTGAAGAAGAAACCAGGGATATTTATTTGCCACTGGCCC
AGCAAATGAGGGAGGATGGCCAACTACGGAAAGCGGAACAGATTTACATC
GGTCTCGGGGAGCCTGATGAGGCTATTTCTATGTAC
back to top
Synonyms
The feature 'OSCA012500-RA' has the following synonyms
Synonym
maker-newscf_14327-snap-gene-0.4-mRNA-1