OSCA012565-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA012565-RA
Unique NameOSCA012565-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1302
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1992contignewscf_1992:1832..3356 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.03
QI363|1|0.5|1|0|0.5|2|0|312
AED0.03
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA012565OSCA012565Ostrinia scapulalisgenenewscf_1992 1832..3356 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012565-RAOSCA012565-PAOstrinia scapulalispolypeptidenewscf_1992 2195..3356 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012565-RA:exon:1043OSCA012565-RA:exon:1043Ostrinia scapulalisexonnewscf_1992 1832..2519 +
OSCA012565-RA:exon:1044OSCA012565-RA:exon:1044Ostrinia scapulalisexonnewscf_1992 2743..3356 +


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012565-RA:five_prime_utrOSCA012565-RA:five_prime_utrOstrinia scapulalisfive_prime_UTRnewscf_1992 1832..2194 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012565-RA:cdsOSCA012565-RA:cdsOstrinia scapulalisCDSnewscf_1992 2743..3356 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA012565-RA ID=OSCA012565-RA|Name=OSCA012565-RA|organism=Ostrinia scapulalis|type=mRNA|length=1302bp
CAGCGAGCCAGCGACTGTCACTAGTGTCACTTGTCAATTGGTAATGTCAG
AGTTGTCAAACTATCAGTCGTCGATTGCCAAAAAAATTACCTTGACATTA
TTCTTCTTTCGAGTCGTGTCTGTATGGAAATAGTACGTCTTTCTTTCATA
TTTTTGAAGTGATAATTCATTAATGTACATGTAGTGGTTTTTATTGTCTG
AATGAATGCACACTCAAACAGAATTAAATTAAAACCTAGAATGCCTCCGC
GGACTGGAGACCGAGAGAGAGGAATATGACACGTCTCACGTCCAACGAGC
CGCAGCGAGAGCGATGCGACGGTGACCGGACTGCCCGGAAATAGAAGAAG
TCCGCAAGTCGCGATGGGGCTGCAGGGCTCGCGGCGCGAGGCGCTGGCGG
TGGCGGCGCTGTGCGCGGCGTGGTACGCCGTGAGCTCGGCCAGCAACGTG
CTGGGCAAGCTGGTGCTCACCGACTTCCCGTTCCCCATGACCGTCACCAT
GGCCCAGCTGCTGGCCATCGTGCTGCTGAGCGCGCCGGCCTTCGGCGCCG
CCGGCGTGCGGCGTGAGACCGACTTCCCGCGCGCCTACTACTGGCGCACG
CTCGTGCCGCTCGCCTTCGCCAAGTTCCTCACCACCGTCTGCTCGCAGGT
CTCCATTTGGAAAGTTCCAATATCTTACGCGCACACTGTGAAGGCGACGA
CGCCGCTGTGGACGGCGGCGCTGGCGCGGCTGCTGTTCGGCGAGCGGCAG
CCGCGCGCGGTGCAGGCGGCGCTGCTGCTGATCGCGGCGGGCGTGGGCGT
GGCGTCGGCCACGGAGCTGCACTTCGACGCGCTGGGGCTGGGCGCCGCGC
TGGCCGCCGCCGCGCTGCTCAGCCTGCAGCACCTGTACTCCAAGCGCGTC
ATGCGCGACACGGGCGTGCACCACCTGCGCCTGCTGCAGGCGCTGGGCCG
GCTGGCGCTGCTGCTGTTCCTGCCNCTGTGGGCGTGGAGCGACGGCGCGG
CGCTGCTGGGCGCGGCGCCGGCGGGCGGCTGGGCGCGCGTGGGCGCGCTG
CTGGCGGGCGACGGCGCGCTGGCGTGGCTGCAGGCGGTGCTGGCGTTCAG
CGTGCTGTCGCGGGTGTCGCCGCTGGCCTACGCGGTGGCGTCGGCGGCCA
AGCGCGCGGCGGTGGTGGGCGCGTCGCTGCTGCTGCTGCGCAACCCGGCG
TCGCCGCTGAACGTGGCGGGCATGGCGCTGGCGGCGGGCGGCGTGCTGGC
CTACAACCGCGCCAAGCTGCGCGCGCGCGAGCGGCCCGCGCTGCCCGTGT
GA
back to top

spliced messenger RNA

>OSCA012565-RA ID=OSCA012565-RA|Name=OSCA012565-RA|organism=Ostrinia scapulalis|type=mRNA|length=1302bp|location=Sequence derived from alignment at newscf_1992:1832..3356+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
CAGCGAGCCAGCGACTGTCACTAGTGTCACTTGTCAATTGGTAATGTCAG
AGTTGTCAAACTATCAGTCGTCGATTGCCAAAAAAATTACCTTGACATTA
TTCTTCTTTCGAGTCGTGTCTGTATGGAAATAGTACGTCTTTCTTTCATA
TTTTTGAAGTGATAATTCATTAATGTACATGTAGTGGTTTTTATTGTCTG
AATGAATGCACACTCAAACAGAATTAAATTAAAACCTAGAATGCCTCCGC
GGACTGGAGACCGAGAGAGAGGAATATGACACGTCTCACGTCCAACGAGC
CGCAGCGAGAGCGATGCGACGGTGACCGGACTGCCCGGAAATAGAAGAAG
TCCGCAAGTCGCGATGGGGCTGCAGGGCTCGCGGCGCGAGGCGCTGGCGG
TGGCGGCGCTGTGCGCGGCGTGGTACGCCGTGAGCTCGGCCAGCAACGTG
CTGGGCAAGCTGGTGCTCACCGACTTCCCGTTCCCCATGACCGTCACCAT
GGCCCAGCTGCTGGCCATCGTGCTGCTGAGCGCGCCGGCCTTCGGCGCCG
CCGGCGTGCGGCGTGAGACCGACTTCCCGCGCGCCTACTACTGGCGCACG
CTCGTGCCGCTCGCCTTCGCCAAGTTCCTCACCACCGTCTGCTCGCAGGT
CTCCATTTGGAAAGTTCCAATATCTTACGCGCACACTGTGAAGGCGACGA
CGCCGCTGTGGACGGCGGCGCTGGCGCGGCTGCTGTTCGGCGAGCGGCAG
CCGCGCGCGGTGCAGGCGGCGCTGCTGCTGATCGCGGCGGGCGTGGGCGT
GGCGTCGGCCACGGAGCTGCACTTCGACGCGCTGGGGCTGGGCGCCGCGC
TGGCCGCCGCCGCGCTGCTCAGCCTGCAGCACCTGTACTCCAAGCGCGTC
ATGCGCGACACGGGCGTGCACCACCTGCGCCTGCTGCAGGCGCTGGGCCG
GCTGGCGCTGCTGCTGTTCCTGCCKCTGTGGGCGTGGAGCGACGGCGCGG
CGCTGCTGGGCGCGGCGCCGGCGGGCGGCTGGGCGCGCGTGGGCGCGCTG
CTGGCGGGCGACGGCGCGCTGGCGTGGCTGCAGGCGGTGCTGGCGTTCAG
CGTGCTGTCGCGGGTGTCGCCGCTGGCCTACGCGGTGGCGTCGGCGGCCA
AGCGCGCGGCGGTGGTGGGCGCGTCGCTGCTGCTGCTGCGCAACCCGGCG
TCGCCGCTGAACGTGGCGGGCATGGCGCTGGCGGCGGGCGGCGTGCTGGC
CTACAACCGCGCCAAGCTGCGCGCGCGCGAGCGGCCCGCGCTGCCCGTGT
GA
back to top

protein sequence of OSCA012565-RA

>OSCA012565-PA ID=OSCA012565-PA|Name=OSCA012565-RA|organism=Ostrinia scapulalis|type=polypeptide|length=312bp
MGLQGSRREALAVAALCAAWYAVSSASNVLGKLVLTDFPFPMTVTMAQLL
AIVLLSAPAFGAAGVRRETDFPRAYYWRTLVPLAFAKFLTTVCSQVSIWK
VPISYAHTVKATTPLWTAALARLLFGERQPRAVQAALLLIAAGVGVASAT
ELHFDALGLGAALAAAALLSLQHLYSKRVMRDTGVHHLRLLQALGRLALL
LFLPLWAWSDGAALLGAAPAGGWARVGALLAGDGALAWLQAVLAFSVLSR
VSPLAYAVASAAKRAAVVGASLLLLRNPASPLNVAGMALAAGGVLAYNRA
KLRARERPALPV
back to top

mRNA from alignment at newscf_1992:1832..3356+

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA012565-RA ID=OSCA012565-RA|Name=OSCA012565-RA|organism=Ostrinia scapulalis|type=mRNA|length=1525bp|location=Sequence derived from alignment at newscf_1992:1832..3356+ (Ostrinia scapulalis)
CAGCGAGCCAGCGACTGTCACTAGTGTCACTTGTCAATTGGTAATGTCAG AGTTGTCAAACTATCAGTCGTCGATTGCCAAAAAAATTACCTTGACATTA TTCTTCTTTCGAGTCGTGTCTGTATGGAAATAGTACGTCTTTCTTTCATA TTTTTGAAGTGATAATTCATTAATGTACATGTAGTGGTTTTTATTGTCTG AATGAATGCACACTCAAACAGAATTAAATTAAAACCTAGAATGCCTCCGC GGACTGGAGACCGAGAGAGAGGAATATGACACGTCTCACGTCCAACGAGC CGCAGCGAGAGCGATGCGACGGTGACCGGACTGCCCGGAAATAGAAGAAG TCCGCAAGTCGCGATGGGGCTGCAGGGCTCGCGGCGCGAGGCGCTGGCGG TGGCGGCGCTGTGCGCGGCGTGGTACGCCGTGAGCTCGGCCAGCAACGTG CTGGGCAAGCTGGTGCTCACCGACTTCCCGTTCCCCATGACCGTCACCAT GGCCCAGCTGCTGGCCATCGTGCTGCTGAGCGCGCCGGCCTTCGGCGCCG CCGGCGTGCGGCGTGAGACCGACTTCCCGCGCGCCTACTACTGGCGCACG CTCGTGCCGCTCGCCTTCGCCAAGTTCCTCACCACCGTCTGCTCGCAGGT CTCCATTTGGAAAGTTCCAATATCTTACGCGCACACTGGTAAGCTCTCGA CGGTCGACCGAAGTCCGATCAGATGTCTCACCAATGAGGCTTTTCGCAAT TTTATTTCGCGCGATATTATTATTCTGTTACGGTCGTACGACATGAATAT GATGATCGCTCAACAGCCGGCGATTCCGTACTTTCACAAGCCTTCATGTT TTCTCGTTTAAACAATTCGTAGCCCGGTAGCCTCACAGTGACCGAGGGTG TGTGTGCGCAGTGAAGGCGACGACGCCGCTGTGGACGGCGGCGCTGGCGC GGCTGCTGTTCGGCGAGCGGCAGCCGCGCGCGGTGCAGGCGGCGCTGCTG CTGATCGCGGCGGGCGTGGGCGTGGCGTCGGCCACGGAGCTGCACTTCGA CGCGCTGGGGCTGGGCGCCGCGCTGGCCGCCGCCGCGCTGCTCAGCCTGC AGCACCTGTACTCCAAGCGCGTCATGCGCGACACGGGCGTGCACCACCTG CGCCTGCTGCAGGCGCTGGGCCGGCTGGCGCTGCTGCTGTTCCTGCCKCT GTGGGCGTGGAGCGACGGCGCGGCGCTGCTGGGCGCGGCGCCGGCGGGCG GCTGGGCGCGCGTGGGCGCGCTGCTGGCGGGCGACGGCGCGCTGGCGTGG CTGCAGGCGGTGCTGGCGTTCAGCGTGCTGTCGCGGGTGTCGCCGCTGGC CTACGCGGTGGCGTCGGCGGCCAAGCGCGCGGCGGTGGTGGGCGCGTCGC TGCTGCTGCTGCGCAACCCGGCGTCGCCGCTGAACGTGGCGGGCATGGCG CTGGCGGCGGGCGGCGTGCTGGCCTACAACCGCGCCAAGCTGCGCGCGCG CGAGCGGCCCGCGCTGCCCGTGTGA
back to top

Coding sequence (CDS) from alignment at newscf_1992:1832..3356+

>OSCA012565-RA ID=OSCA012565-RA|Name=OSCA012565-RA|organism=Ostrinia scapulalis|type=CDS|length=939bp|location=Sequence derived from alignment at newscf_1992:1832..3356+ (Ostrinia scapulalis)
ATGGGGCTGCAGGGCTCGCGGCGCGAGGCGCTGGCGGTGGCGGCGCTGTG
CGCGGCGTGGTACGCCGTGAGCTCGGCCAGCAACGTGCTGGGCAAGCTGG
TGCTCACCGACTTCCCGTTCCCCATGACCGTCACCATGGCCCAGCTGCTG
GCCATCGTGCTGCTGAGCGCGCCGGCCTTCGGCGCCGCCGGCGTGCGGCG
TGAGACCGACTTCCCGCGCGCCTACTACTGGCGCACGCTCGTGCCGCTCG
CCTTCGCCAAGTTCCTCACCACCGTCTGCTCGCAGGTCTCCATTTGGAAA
GTTCCAATATCTTACGCGCACACTGTGAAGGCGACGACGCCGCTGTGGAC
GGCGGCGCTGGCGCGGCTGCTGTTCGGCGAGCGGCAGCCGCGCGCGGTGC
AGGCGGCGCTGCTGCTGATCGCGGCGGGCGTGGGCGTGGCGTCGGCCACG
GAGCTGCACTTCGACGCGCTGGGGCTGGGCGCCGCGCTGGCCGCCGCCGC
GCTGCTCAGCCTGCAGCACCTGTACTCCAAGCGCGTCATGCGCGACACGG
GCGTGCACCACCTGCGCCTGCTGCAGGCGCTGGGCCGGCTGGCGCTGCTG
CTGTTCCTGCCKCTGTGGGCGTGGAGCGACGGCGCGGCGCTGCTGGGCGC
GGCGCCGGCGGGCGGCTGGGCGCGCGTGGGCGCGCTGCTGGCGGGCGACG
GCGCGCTGGCGTGGCTGCAGGCGGTGCTGGCGTTCAGCGTGCTGTCGCGG
GTGTCGCCGCTGGCCTACGCGGTGGCGTCGGCGGCCAAGCGCGCGGCGGT
GGTGGGCGCGTCGCTGCTGCTGCTGCGCAACCCGGCGTCGCCGCTGAACG
TGGCGGGCATGGCGCTGGCGGCGGGCGGCGTGCTGGCCTACAACCGCGCC
AAGCTGCGCGCGCGCGAGCGGCCCGCGCTGCCCGTGTGA
back to top
Synonyms
The feature 'OSCA012565-RA' has the following synonyms
Synonym
maker-newscf_1992-snap-gene-0.17-mRNA-1