OSCA012566-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA012566-RA
Unique NameOSCA012566-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length3833
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1992contignewscf_1992:26771..37598 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.02
QI0|1|0.8|1|1|1|5|152|1226
AED0.02
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA012566OSCA012566Ostrinia scapulalisgenenewscf_1992 26771..37598 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012566-RAOSCA012566-PAOstrinia scapulalispolypeptidenewscf_1992 26923..37598 -


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012566-RA:three_prime_utrOSCA012566-RA:three_prime_utrOstrinia scapulalisthree_prime_UTRnewscf_1992 26771..26922 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012566-RA:cdsOSCA012566-RA:cdsOstrinia scapulalisCDSnewscf_1992 26923..27295 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012566-RA:exon:1046OSCA012566-RA:exon:1046Ostrinia scapulalisexonnewscf_1992 34824..37598 -
OSCA012566-RA:exon:1047OSCA012566-RA:exon:1047Ostrinia scapulalisexonnewscf_1992 34331..34510 -
OSCA012566-RA:exon:1048OSCA012566-RA:exon:1048Ostrinia scapulalisexonnewscf_1992 32325..32466 -
OSCA012566-RA:exon:1049OSCA012566-RA:exon:1049Ostrinia scapulalisexonnewscf_1992 30943..31153 -
OSCA012566-RA:exon:1050OSCA012566-RA:exon:1050Ostrinia scapulalisexonnewscf_1992 26771..27295 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA012566-RA ID=OSCA012566-RA|Name=OSCA012566-RA|organism=Ostrinia scapulalis|type=mRNA|length=3833bp
ATGGCAACGTGCGGTGTGACGTTTCTAATTGAATATTATTATTGTTTCAG
TGGCGTAGCGGTGCATAGTCCGACGGAAAGCGGCGGGTGCAGCAGCAGTG
ACATCACCGAGCCGGGTTCGCCGCGCAGCCCCGAGTCGTCGTGCAGCGCG
CCAGAGGAGAGCGCGGGCGCGGGCGCGCGTATGCCGCCGTGGGCGAGCGA
GCCGGCGCCGCCGGGCCCGCGACGCCTCGCGGCCCAACCCGCGCCCGTGC
GACGCCCCCAGCCTCCCATACGACGTCGCATCACAGAATACTTCAGCCAC
AAAATGAAGCCTCAAAACGGCCTAAAGCGCGACTCCAACGCGACCAATAA
CGAAGACACCAAAAGAAAGTGCCTACCCAAAAACGGCGTCACGGACGACT
TAGAGAAATACATCTCGTATCTGTCACAGACGCTCAGTCCTAAGGTCCTG
ATGGATGTTGGGAAACAAGCAGAAACCATGAAGAAACCCAACTCTACCGT
CAACGGGGTTGTTGATTCCACCAAACCGACAGATCTCAGTAAAGTGACGC
CTAATACGAATATTAGCAGTCAGCTTGATTTCAGTAGGTCTAAGGAGNGT
AGAGAAAAAAATCATCATACCAGCATGAATGGTTTTGTTGAAGTTAGGCA
TGCGACCGAATCGTTCCAAACGACCAAAGAGAAACTTTCAAATGGGCTTC
TAAACGGGTTGGTCGACGGTAAAAAGCAGAACCTCGATAATAAAGCAACA
CCAGACCCATCCGCCAATTGCACAAAGTATAATACCACAAATACCATAGG
AGCAGCTAAAAGAAAAGTACCTATACCAATGTCAAACGAATTAAATGGAG
TAAGAATAGCACCAGCTACATCTGCCAGTCATATGCCGAAGAAATCATTG
ATTTCAAAACCTGACTCAACGAGAGTAAATGGTGTTGTTAGTTCCACTAC
TAAGTTAGATAGTAGAATGAATGGGGTCACCATTGGATCAAATAACTTAG
GTTTAAGTTCTGAAATCACCATAACGAAGAAAGAAGTTCCAAAGAAGACC
ACTCCTCAAGCTAAAAGAACAAATCGAAAATCTTCAGCTTGCATAGCTAA
CAGCAAAAACCTTACTTGGTCTAAGGTTAATAACCTGAAACAAGTACAGC
TTCAGCAAAAAAATTGTGTTAATTCTACTCAGAATTCATCCATGCAAAAT
TTACCAGGTGAAGCAAACACAGCACCAAAGATGAATATCCCAAATGGTGT
TCGTCAAGTTCCAATGACGATTAATGGGAATCTCGGTAGTATAAATGTAC
CTGTGAACAATTTACAGAACTGTCACCAAATAAATATTCCCCAGCCTTGT
AATGGAGCAGTGAATTCAAATAATTTACCTTCATTTGTAGCGGTCCCCCA
AAATGTTATGTTAGCCACGTTAAGGATACCACAGAATGGAATACCGGCAC
AAACGTTAACGCAACAAAGTAATATGACCGCTTTTAATAGGCCAAATGTC
AATGTGTCAAGCCCGACAAAGTTGAACGGCCAATTTGTGTTTCCACTCAT
GCAGAATATCAATGGAACCGTTCTGCAAATACCAAATCTAATGGCTAAAA
TGCCTAATTTTGTTCTTCCTCAAACACCGCAGCTAACAACACCCAGGCAA
GACCATTTACAGAATCAACAAACGGCACAAATTCTCATAAACGGTACTCT
TTTAAAGTTAGCTAACACGATGACGTCTACGTACCCTAATGTCAACAAGA
CGGCTCCTGTTACAAGTCAACCTATTCCTGTAATGAATAAAAACGTTCCT
GGAATACAACCCGTGGGAATAACCCATATGCAGTCCAAACCGAATTATAC
CGTTAACCTAAGCCATCCTGTTCTAATGCCTCAACCTGGGTACATAGTGA
CATCTGTGCCAAATATGAATGTGAAAGAGACATGGAGCTACACGAACACT
GCCTTATCATCATCACAAATAACGTGTTCTAATCCAATAGTCCATCACCC
GCCACCTCTAGTAGCGAACTTTACTACGGAAGCCTTACATACAAGTAGTA
TACCAATAGCGCCGGTCAAGCCGCCCGACAATCCAATTCAGGGCACAGAC
CCGCCTAGTAGTACTGTAAAAGAAGAAGTGTGTGAGGTAACAAGTTCAAA
GTATGATATACCGTGGCTTTCAAAAACTGTTAACAATAACATTGTTCCGC
TAGATTCTAATAAACTAAATTCGAGGCCTTTTGCACAAGTTTACTCGGAG
AGATTAGACGAATTTCATGTAGAGAAAGTGCGAGAAACTCTGATAGAGTC
CTCCACGATCATAGACGTTGAATGTGCTAAAGACTTAAGGAAGATTAAAG
AAGTAGCAAGAAGAGAAGAGACTATTTTCACTCAGATAACTGTGTTGAAA
GACGTTTCGTCTAACGTTCAAAGTACTGTGATAGAAGAAACTTACTGTAG
CACCACTACGGAGTCGTCAGAGTCGGGGATCGGTACTGACAAGTCTATCG
ACTCCCCGAGCGACTCGCAAACCAGTAAGGAATGTGATGACGACTCATCG
TTATCGTTAAGTATAAGTTTGTGTTCAGTGGACGTGCAGAGTAGCCAGAA
GAGTCCAATTCTGAAGCAGCCGAAAACGTTGAGGTTTCCACCGAGGAATC
CAGCGAAATCCGGTAGTAATCAAAGGACGTCAAGTACTGATACAACATCA
ACAGTTACATTATGTATGTGGGAAAACTGCAAAAGTGAATTCGAGAGTGA
CACAGATCTCTTGGAGCACTTACAGTCAGTCCATGTGGAGAGCCAAGCAG
GAAAGGAAAACTACGTGTGCCTATGGCAGAAGTGCAAGGTCCGAGGGAAG
CCCTCCTGTTCGCGGCTCTGGTTGCAAAGGCACGCCCTTTCCCACGGAGG
GAACAAACCCTTCAAATGCATCGTCGACGGCTGCGACAGAAGGTTCTCCA
CACAGATATTGTTGGAAAGGCACGTAAACAACCACTTCAACGAGGTTTCT
CCAGGGACGAACGGCAGCAAGAAAGCGGTTGATAGTGCTTCCAAGTTAAT
ACGAAGGAATGGCAAGAAACTGCGGTATAGAAGGCAACCTTGGTCGGCGC
GCATGTTCGACTTCTTCGACGCTAGCATGATGGAAGGTCTGGCGTGGCGG
CTGGGGCGCGTCACCCGCTGGCGGCTGGGCGGCGGCTGTCCCTTGCGCGA
GCCGCCCGGCCGACACACGCTGACGCTACACGCCGCGCTACAGGCCACGC
GGTACAACGCACAAGCGCACGCGCATGAAGCGCTGCTGACGTACTACCCG
CCCCATGTGATCGAAGACGAATGGGTGCCTGAGAAAGACGTGAAGCGGAT
CAAGCGTGTCGAGATAGCTACGTTGCCCGCGCACACAAAAGTACTACTCT
ACGAGCAGTTTTGNGCGGCGTATCGCGTCAGTCCATCCCCACCGCCGCCG
AAAAAGGCCGTCCCTACCACGCGAGTTCTACCAGCGAGGCACTGCACATC
CTCGCGACTCCTCAACAAGTTACTGGCGAAGCAAAAGCAGAAAAAATCGG
AATGCTCCACGCCGGATCTCGCTGCGTTNTACAAGCCGCCGCCGGAACGC
GTCGAAGTCAGCGGCGCCAAGAAACGCAAGATGGGCCGCCGGTATGGCGG
CTACGACGCCTTCTGGCCCTCCGGACGATAATTCCCTATCTGTNAGCTCG
CTATGAATCTGTTTCGTCTTTTCTTTTAATCTGCGATAATGTAGCCTTGA
TTTAAGTACTATTATAGTATAACACCTTAAGTGTAGCCGCTCAGTAAGTG
CCTATTCATCAGTAAGTTAGATAACGTCTGAAA
back to top

spliced messenger RNA

>OSCA012566-RA ID=OSCA012566-RA|Name=OSCA012566-RA|organism=Ostrinia scapulalis|type=mRNA|length=3833bp|location=Sequence derived from alignment at newscf_1992:26771..37598- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGCAACGTGCGGTGTGACGTTTCTAATTGAATATTATTATTGTTTCAG
TGGCGTAGCGGTGCATAGTCCGACGGAAAGCGGCGGGTGCAGCAGCAGTG
ACATCACCGAGCCGGGTTCGCCGCGCAGCCCCGAGTCGTCGTGCAGCGCG
CCAGAGGAGAGCGCGGGCGCGGGCGCGCGTATGCCGCCGTGGGCGAGCGA
GCCGGCGCCGCCGGGCCCGCGACGCCTCGCGGCCCAACCCGCGCCCGTGC
GACGCCCCCAGCCTCCCATACGACGTCGCATCACAGAATACTTCAGCCAC
AAAATGAAGCCTCAAAACGGCCTAAAGCGCGACTCCAACGCGACCAATAA
CGAAGACACCAAAAGAAAGTGCCTACCCAAAAACGGCGTCACGGACGACT
TAGAGAAATACATCTCGTATCTGTCACAGACGCTCAGTCCTAAGGTCCTG
ATGGATGTTGGGAAACAAGCAGAAACCATGAAGAAACCCAACTCTACCGT
CAACGGGGTTGTTGATTCCACCAAACCGACAGATCTCAGTAAAGTGACGC
CTAATACGAATATTAGCAGTCAGCTTGATTTCAGTAGGTCTAAGGAGKGT
AGAGAAAAAAATCATCATACCAGCATGAATGGTTTTGTTGAAGTTAGGCA
TGCGACCGAATCGTTCCAAACGACCAAAGAGAAACTTTCAAATGGGCTTC
TAAACGGGTTGGTCGACGGTAAAAAGCAGAACCTCGATAATAAAGCAACA
CCAGACCCATCCGCCAATTGCACAAAGTATAATACCACAAATACCATAGG
AGCAGCTAAAAGAAAAGTACCTATACCAATGTCAAACGAATTAAATGGAG
TAAGAATAGCACCAGCTACATCTGCCAGTCATATGCCGAAGAAATCATTG
ATTTCAAAACCTGACTCAACGAGAGTAAATGGTGTTGTTAGTTCCACTAC
TAAGTTAGATAGTAGAATGAATGGGGTCACCATTGGATCAAATAACTTAG
GTTTAAGTTCTGAAATCACCATAACGAAGAAAGAAGTTCCAAAGAAGACC
ACTCCTCAAGCTAAAAGAACAAATCGAAAATCTTCAGCTTGCATAGCTAA
CAGCAAAAACCTTACTTGGTCTAAGGTTAATAACCTGAAACAAGTACAGC
TTCAGCAAAAAAATTGTGTTAATTCTACTCAGAATTCATCCATGCAAAAT
TTACCAGGTGAAGCAAACACAGCACCAAAGATGAATATCCCAAATGGTGT
TCGTCAAGTTCCAATGACGATTAATGGGAATCTCGGTAGTATAAATGTAC
CTGTGAACAATTTACAGAACTGTCACCAAATAAATATTCCCCAGCCTTGT
AATGGAGCAGTGAATTCAAATAATTTACCTTCATTTGTAGCGGTCCCCCA
AAATGTTATGTTAGCCACGTTAAGGATACCACAGAATGGAATACCGGCAC
AAACGTTAACGCAACAAAGTAATATGACCGCTTTTAATAGGCCAAATGTC
AATGTGTCAAGCCCGACAAAGTTGAACGGCCAATTTGTGTTTCCACTCAT
GCAGAATATCAATGGAACCGTTCTGCAAATACCAAATCTAATGGCTAAAA
TGCCTAATTTTGTTCTTCCTCAAACACCGCAGCTAACAACACCCAGGCAA
GACCATTTACAGAATCAACAAACGGCACAAATTCTCATAAACGGTACTCT
TTTAAAGTTAGCTAACACGATGACGTCTACGTACCCTAATGTCAACAAGA
CGGCTCCTGTTACAAGTCAACCTATTCCTGTAATGAATAAAAACGTTCCT
GGAATACAACCCGTGGGAATAACCCATATGCAGTCCAAACCGAATTATAC
CGTTAACCTAAGCCATCCTGTTCTAATGCCTCAACCTGGGTACATAGTGA
CATCTGTGCCAAATATGAATGTGAAAGAGACATGGAGCTACACGAACACT
GCCTTATCATCATCACAAATAACGTGTTCTAATCCAATAGTCCATCACCC
GCCACCTCTAGTAGCGAACTTTACTACGGAAGCCTTACATACAAGTAGTA
TACCAATAGCGCCGGTCAAGCCGCCCGACAATCCAATTCAGGGCACAGAC
CCGCCTAGTAGTACTGTAAAAGAAGAAGTGTGTGAGGTAACAAGTTCAAA
GTATGATATACCGTGGCTTTCAAAAACTGTTAACAATAACATTGTTCCGC
TAGATTCTAATAAACTAAATTCGAGGCCTTTTGCACAAGTTTACTCGGAG
AGATTAGACGAATTTCATGTAGAGAAAGTGCGAGAAACTCTGATAGAGTC
CTCCACGATCATAGACGTTGAATGTGCTAAAGACTTAAGGAAGATTAAAG
AAGTAGCAAGAAGAGAAGAGACTATTTTCACTCAGATAACTGTGTTGAAA
GACGTTTCGTCTAACGTTCAAAGTACTGTGATAGAAGAAACTTACTGTAG
CACCACTACGGAGTCGTCAGAGTCGGGGATCGGTACTGACAAGTCTATCG
ACTCCCCGAGCGACTCGCAAACCAGTAAGGAATGTGATGACGACTCATCG
TTATCGTTAAGTATAAGTTTGTGTTCAGTGGACGTGCAGAGTAGCCAGAA
GAGTCCAATTCTGAAGCAGCCGAAAACGTTGAGGTTTCCACCGAGGAATC
CAGCGAAATCCGGTAGTAATCAAAGGACGTCAAGTACTGATACAACATCA
ACAGTTACATTATGTATGTGGGAAAACTGCAAAAGTGAATTCGAGAGTGA
CACAGATCTCTTGGAGCACTTACAGTCAGTCCATGTGGAGAGCCAAGCAG
GAAAGGAAAACTACGTGTGCCTATGGCAGAAGTGCAAGGTCCGAGGGAAG
CCCTCCTGTTCGCGGCTCTGGTTGCAAAGGCACGCCCTTTCCCACGGAGG
GAACAAACCCTTCAAATGCATCGTCGACGGCTGCGACAGAAGGTTCTCCA
CACAGATATTGTTGGAAAGGCACGTAAACAACCACTTCAACGAGGTTTCT
CCAGGGACGAACGGCAGCAAGAAAGCGGTTGATAGTGCTTCCAAGTTAAT
ACGAAGGAATGGCAAGAAACTGCGGTATAGAAGGCAACCTTGGTCGGCGC
GCATGTTCGACTTCTTCGACGCTAGCATGATGGAAGGTCTGGCGTGGCGG
CTGGGGCGCGTCACCCGCTGGCGGCTGGGCGGCGGCTGTCCCTTGCGCGA
GCCGCCCGGCCGACACACGCTGACGCTACACGCCGCGCTACAGGCCACGC
GGTACAACGCACAAGCGCACGCGCATGAAGCGCTGCTGACGTACTACCCG
CCCCATGTGATCGAAGACGAATGGGTGCCTGAGAAAGACGTGAAGCGGAT
CAAGCGTGTCGAGATAGCTACGTTGCCCGCGCACACAAAAGTACTACTCT
ACGAGCAGTTTTGYGCGGCGTATCGCGTCAGTCCATCCCCACCGCCGCCG
AAAAAGGCCGTCCCTACCACGCGAGTTCTACCAGCGAGGCACTGCACATC
CTCGCGACTCCTCAACAAGTTACTGGCGAAGCAAAAGCAGAAAAAATCGG
AATGCTCCACGCCGGATCTCGCTGCGTTRTACAAGCCGCCGCCGGAACGC
GTCGAAGTCAGCGGCGCCAAGAAACGCAAGATGGGCCGCCGGTATGGCGG
CTACGACGCCTTCTGGCCCTCCGGACGATAATTCCCTATCTGTRAGCTCG
CTATGAATCTGTTTCGTCTTTTCTTTTAATCTGCGATAATGTAGCCTTGA
TTTAAGTACTATTATAGTATAACACCTTAAGTGTAGCCGCTCAGTAAGTG
CCTATTCATCAGTAAGTTAGATAACGTCTGAAA
back to top

protein sequence of OSCA012566-RA

>OSCA012566-PA ID=OSCA012566-PA|Name=OSCA012566-RA|organism=Ostrinia scapulalis|type=polypeptide|length=1226bp
MATCGVTFLIEYYYCFSGVAVHSPTESGGCSSSDITEPGSPRSPESSCSA
PEESAGAGARMPPWASEPAPPGPRRLAAQPAPVRRPQPPIRRRITEYFSH
KMKPQNGLKRDSNATNNEDTKRKCLPKNGVTDDLEKYISYLSQTLSPKVL
MDVGKQAETMKKPNSTVNGVVDSTKPTDLSKVTPNTNISSQLDFSRSKEX
REKNHHTSMNGFVEVRHATESFQTTKEKLSNGLLNGLVDGKKQNLDNKAT
PDPSANCTKYNTTNTIGAAKRKVPIPMSNELNGVRIAPATSASHMPKKSL
ISKPDSTRVNGVVSSTTKLDSRMNGVTIGSNNLGLSSEITITKKEVPKKT
TPQAKRTNRKSSACIANSKNLTWSKVNNLKQVQLQQKNCVNSTQNSSMQN
LPGEANTAPKMNIPNGVRQVPMTINGNLGSINVPVNNLQNCHQINIPQPC
NGAVNSNNLPSFVAVPQNVMLATLRIPQNGIPAQTLTQQSNMTAFNRPNV
NVSSPTKLNGQFVFPLMQNINGTVLQIPNLMAKMPNFVLPQTPQLTTPRQ
DHLQNQQTAQILINGTLLKLANTMTSTYPNVNKTAPVTSQPIPVMNKNVP
GIQPVGITHMQSKPNYTVNLSHPVLMPQPGYIVTSVPNMNVKETWSYTNT
ALSSSQITCSNPIVHHPPPLVANFTTEALHTSSIPIAPVKPPDNPIQGTD
PPSSTVKEEVCEVTSSKYDIPWLSKTVNNNIVPLDSNKLNSRPFAQVYSE
RLDEFHVEKVRETLIESSTIIDVECAKDLRKIKEVARREETIFTQITVLK
DVSSNVQSTVIEETYCSTTTESSESGIGTDKSIDSPSDSQTSKECDDDSS
LSLSISLCSVDVQSSQKSPILKQPKTLRFPPRNPAKSGSNQRTSSTDTTS
TVTLCMWENCKSEFESDTDLLEHLQSVHVESQAGKENYVCLWQKCKVRGK
PSCSRLWLQRHALSHGGNKPFKCIVDGCDRRFSTQILLERHVNNHFNEVS
PGTNGSKKAVDSASKLIRRNGKKLRYRRQPWSARMFDFFDASMMEGLAWR
LGRVTRWRLGGGCPLREPPGRHTLTLHAALQATRYNAQAHAHEALLTYYP
PHVIEDEWVPEKDVKRIKRVEIATLPAHTKVLLYEQFXAAYRVSPSPPPP
KKAVPTTRVLPARHCTSSRLLNKLLAKQKQKKSECSTPDLAAXYKPPPER
VEVSGAKKRKMGRRYGGYDAFWPSGR
back to top

mRNA from alignment at newscf_1992:26771..37598-

Legend: polypeptideCDSexonthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA012566-RA ID=OSCA012566-RA|Name=OSCA012566-RA|organism=Ostrinia scapulalis|type=mRNA|length=10828bp|location=Sequence derived from alignment at newscf_1992:26771..37598- (Ostrinia scapulalis)
ATGGCAACGTGCGGTGTGACGTTTCTAATTGAATATTATTATTGTTTCAG TGGCGTAGCGGTGCATAGTCCGACGGAAAGCGGCGGGTGCAGCAGCAGTG ACATCACCGAGCCGGGTTCGCCGCGCAGCCCCGAGTCGTCGTGCAGCGCG CCAGAGGAGAGCGCGGGCGCGGGCGCGCGTATGCCGCCGTGGGCGAGCGA GCCGGCGCCGCCGGGCCCGCGACGCCTCGCGGCCCAACCCGCGCCCGTGC GACGCCCCCAGCCTCCCATACGACGTCGCATCACAGAATACTTCAGCCAC AAAATGAAGCCTCAAAACGGCCTAAAGCGCGACTCCAACGCGACCAATAA CGAAGACACCAAAAGAAAGTGCCTACCCAAAAACGGCGTCACGGACGACT TAGAGAAATACATCTCGTATCTGTCACAGACGCTCAGTCCTAAGGTCCTG ATGGATGTTGGGAAACAAGCAGAAACCATGAAGAAACCCAACTCTACCGT CAACGGGGTTGTTGATTCCACCAAACCGACAGATCTCAGTAAAGTGACGC CTAATACGAATATTAGCAGTCAGCTTGATTTCAGTAGGTCTAAGGAGKGT AGAGAAAAAAATCATCATACCAGCATGAATGGTTTTGTTGAAGTTAGGCA TGCGACCGAATCGTTCCAAACGACCAAAGAGAAACTTTCAAATGGGCTTC TAAACGGGTTGGTCGACGGTAAAAAGCAGAACCTCGATAATAAAGCAACA CCAGACCCATCCGCCAATTGCACAAAGTATAATACCACAAATACCATAGG AGCAGCTAAAAGAAAAGTACCTATACCAATGTCAAACGAATTAAATGGAG TAAGAATAGCACCAGCTACATCTGCCAGTCATATGCCGAAGAAATCATTG ATTTCAAAACCTGACTCAACGAGAGTAAATGGTGTTGTTAGTTCCACTAC TAAGTTAGATAGTAGAATGAATGGGGTCACCATTGGATCAAATAACTTAG GTTTAAGTTCTGAAATCACCATAACGAAGAAAGAAGTTCCAAAGAAGACC ACTCCTCAAGCTAAAAGAACAAATCGAAAATCTTCAGCTTGCATAGCTAA CAGCAAAAACCTTACTTGGTCTAAGGTTAATAACCTGAAACAAGTACAGC TTCAGCAAAAAAATTGTGTTAATTCTACTCAGAATTCATCCATGCAAAAT TTACCAGGTGAAGCAAACACAGCACCAAAGATGAATATCCCAAATGGTGT TCGTCAAGTTCCAATGACGATTAATGGGAATCTCGGTAGTATAAATGTAC CTGTGAACAATTTACAGAACTGTCACCAAATAAATATTCCCCAGCCTTGT AATGGAGCAGTGAATTCAAATAATTTACCTTCATTTGTAGCGGTCCCCCA AAATGTTATGTTAGCCACGTTAAGGATACCACAGAATGGAATACCGGCAC AAACGTTAACGCAACAAAGTAATATGACCGCTTTTAATAGGCCAAATGTC AATGTGTCAAGCCCGACAAAGTTGAACGGCCAATTTGTGTTTCCACTCAT GCAGAATATCAATGGAACCGTTCTGCAAATACCAAATCTAATGGCTAAAA TGCCTAATTTTGTTCTTCCTCAAACACCGCAGCTAACAACACCCAGGCAA GACCATTTACAGAATCAACAAACGGCACAAATTCTCATAAACGGTACTCT TTTAAAGTTAGCTAACACGATGACGTCTACGTACCCTAATGTCAACAAGA CGGCTCCTGTTACAAGTCAACCTATTCCTGTAATGAATAAAAACGTTCCT GGAATACAACCCGTGGGAATAACCCATATGCAGTCCAAACCGAATTATAC CGTTAACCTAAGCCATCCTGTTCTAATGCCTCAACCTGGGTACATAGTGA CATCTGTGCCAAATATGAATGTGAAAGAGACATGGAGCTACACGAACACT GCCTTATCATCATCACAAATAACGTGTTCTAATCCAATAGTCCATCACCC GCCACCTCTAGTAGCGAACTTTACTACGGAAGCCTTACATACAAGTAGTA TACCAATAGCGCCGGTCAAGCCGCCCGACAATCCAATTCAGGGCACAGAC CCGCCTAGTAGTACTGTAAAAGAAGAAGTGTGTGAGGTAACAAGTTCAAA GTATGATATACCGTGGCTTTCAAAAACTGTTAACAATAACATTGTTCCGC TAGATTCTAATAAACTAAATTCGAGGCCTTTTGCACAAGTTTACTCGGAG AGATTAGACGAATTTCATGTAGAGAAAGTGCGAGAAACTCTGATAGAGTC CTCCACGATCATAGACGTTGAATGTGCTAAAGACTTAAGGAAGATTAAAG AAGTAGCAAGAAGAGAAGAGACTATTTTCACTCAGATAACTGTGTTGAAA GACGTTTCGTCTAACGTTCAAAGTACTGTGATAGAAGAAACTTACTGTAG CACCACTACGGAGTCGTCAGAGTCGGGGATCGGTACTGACAAGTCTATCG ACTCCCCGAGCGACTCGCAAACCAGTAAGGAATGTGATGACGACTCATCG TTATCGTTAAGTATAAGTTTGTGTTCAGTGGACGTGCAGAGTAGCCAGAA GAGTCCAATTCTGAAGCAGCCGAAAACGTTGAGGTTTCCACCGAGGAATC CAGCGAAATCCGGTAGTAATCAAAGGACGTCAAGTACTGATACAACATCA ACAGTTACATTATGTATGTGGGAAAACTGCAAAAGTGAATTCGAGAGTGA CACAGATCTCTTGGAGCACTTACAGGTGAGCATCTTAATTTTGTTTTCGC AAAATAAGAAACCCCCATTAATAACACATTTTGTGGTCGGCAACAATACA GTCCTTTGTTTACAAATTGTGCACCCAAGTACCCATATACATTTYGAAAT GAAATGAGCTTACATACAAACGAATACAAACAAAAAGGTTCACTTCCGCA CCCTCAAAATTTTAAAATCCCTTTTTTATAACTTTCACTATGTTTATTCT TATGTTCCTTACGAAAATGCTTTGAATTAATAATATATTATTAAGCTTTT AAAACATTAACTGATCTTTCTCTTTTTACCCATTCCAGTCAGTCCATGTG GAGAGCCAAGCAGGAAAGGAAAACTACGTGTGCCTATGGCAGAAGTGCAA GGTCCGAGGGAAGCCCTCCTGTTCGCGGCTCTGGTTGCAAAGGCACGCCC TTTCCCACGGAGGGAACAAACCCTTCAAATGCATCGTCGACGGCTGCGAC AGAAGGTTCTCCACACAGGTACATTCTTTCTCCTCGATCTCTGCGTACAG ATGGCAGACCCTAAAAATTAAAACTACGTCAATCGTCGGCTAGGGTTAAG TTCGCGCAAAACTTAGATGATATTAAGTGCGGGAACAGTGAGTGGATTAA AAAAGTTTCAATACAATTTATGCGGAGTTATGAATATTAAGATAAAAAAT CAAATACTTTAGCCGACGATAATTAAAAAATTAAAAAAGTGAAAGCAAGC AGACAGGATTTGGGTATTTATGATTCGGGTCTAAACAAGTAACGGACTGT TCATACAATTCTAAGCAGTTGATGTATTTATGCGTGTTCTATGTTTCTAA AACTGTCCGTTTCCAGAAGTACAGTCCGCCATTTGCTTTGGCCCATAGTT AGTTACTAATCATTATAATAGGTCTTACTAATGTTATATTCATTGCAAAG TCCTTTGAAAGTAGGTCCAATCTTATGTCGTCAATACCTCATAGAATAAA CTCTATTTCAATATTATGTAACCTGTGGTTACAAACTTCCTCAAGGTATG CACCCAATTGAATAGTACCTAAAGGTACGGTACTTATTCTAAAAACAAAA TATGCAAAAGTCTGATTTTTAGTAGATTTTCTAGAATTTTCTTCATTCTT TTAATATACGAGTACCTCTTGTAATTAAGGATTTTGAATGGTCGTTTAGT TTTCTGGTGCAGAACCTACATGTCGTCTTCAAAATTAAATTATTTCTCTG TATCGTGTATTAATATAAGTACCATTTTTTATTATTTTTACCTTTCTGTT TATTAAGTTAAAAATTGGGGCAGTAAAATTGGGTTGTTCTTTCTTTTTTT TTTAATTAAATAAATACGTTATTAATCTGTTTGTGACATTAAATTGGTTT TCGGGACGGGAGTTTACATGTATATCTTTATTGTTTGATTAAAAGAGGTG TGTAGGTTAATAGTTTTCTTTTTGTTGTTCAGATTAAGTTAGTTTCATCG TAGAAAACTTGTGTGTAAATATTGTATCGTGTGTGTATTTTTGGGTGATC TCTTCAAATCACGGCCAATCTTCTAGTGATTGGATTATAATCACGTGGTT GAAGTAGATTCTGTTTTGTGGAGATATAAATATTGTCGTCAAACTTTTTS ATTGTCTCCTAGTCGTCTTTCGTCAGTTTTGTTAATACGTGCCGTGATTC AATCGCTGGATGATCACGTGGCACATCACTATAGTCATTTAATAAAAAAT CTCTTCTTAATTCAGTGTCGTCCATTTAGTATCGTCAGGCTTTAAGMCAT TATTTAAATTTTAATTAAGAGTCTTCCATAAAGTCAATTTTGCATTTTTC ATATCGTTTAGCGTCTTCGTCATTAAAATTATGTAGTAAAAGTGATGTGA CCACATTTGGCGTTGATTTTTAGAGCAATATCGCTCAAAAATGTATGTTA AAATGTGTGTTATGTTTTCTTTCCTAAGGGTTCGAGACTACGCAACAAAG TCCCTGTGCCTGATCCACTCCGTGTCTTATCATTTTTGTCTCCCAATAAA TTTATTTGACCTTCGAAATTTGATAAATTTATTGTTCGACATATTTAATT TTTTTATTCACATCGAGACGAGCTGATGAAATAAAGGATGATACAAGTAT TGTGCTAGGACTAGCTAGATTAAGTTAGTATGCTTTCTTCCAGAGATTTG TTACTTCTTCTTCTTCTTCGGATAGAATCTGTGTATGATWTTGTGAATGA TGATGATGTGTTTTGAATCAAACACAGTCGRCATCTTCTGGGTAGGCTCT TCGAAATCTTCAAGGATAACTGTTACCCATTTAATATTCTTGATTCTCAT CCTAAATCTAACTTGAKGGTATTACTTTACAGATATTGTTGGAAAGGCAC GTAAACAACCACTTCAACGAGGTTTCTCCAGGGACGAACGGCAGCAAGAA AGCGGTTGATAGTGCTTCCAAGTTAATACGAAGGAATGGCAAGAAACTGC GGTATAGAAGGCAACCTTGGTCGGGTGAGTTTGATATTTATCGTTTTACA TATACTGCGAGTTAATTTCACTCAGTTCAGCATGCTTTTGATTCGTGTCA TCGAGTTCAAACCTCCACCAATATTTTTGGTTTCATTAACCACACTCAAT GGTCCACTCTACGAGTGCACAGAAAAGGCTGCAGCGCGGGAGGAATGGCA ACGGATTGTGAGGCTTGCCACCGGACCGGGTGTGACGACCACTCTGGCAA AAGTGTAGCGACGAAGAAGAAGAACTGAAATAGTCACCCACTCTATCATA ATGCTTGAACTTGCTACTCTTAAAGTCATTGATCCCATTACTTCATTTAC TCATTTATTTTTTCGACAACGAGTTTAGCTTCAGCTATCCATCAGTCTTT TTGACTACGAGATTATCTCATTGTCCCATAGTTAGCTGTTATGTTATCCT ATTACATATTATCACTGTTTGATCGCATCATATGTTTTTGGGGTGTAGTT CAGCGATCCAGCATCGAAATAGACTCTGAGACCAGCTCACTGTCATTTGA AAGAAAGAAAGAAATGTTTATTTGGCACCAAATTACATGCACTTCTTAAA AACCTACACAATATTTAACTTATTCTAATACAAAACAAAAATTATATAAA ATTTATAATTTTGGTACCAAATTGGGCTCCGCTCAGTAAAGGCAGTGACG GCGCAGAGCTCGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNATTTTATTTAGGATAACAAACAATTG TACAATTCAGATATGCAGTAAAGTTATACATCGACATTTAGTTATTGTAC AACCCGCACCGCTATCCCCATCTTACAAACATGCTTTGCCTCTTTGCACT ACTAGCTGATTTATGGAAATGAACAGAACAATCCGTGGAACCCACGGATA CCTCTATTCATTCTGTTGTTTAACCAACTCTATTATCATTTCCAGCGCGC ATGTTCGACTTCTTCGACGCTAGCATGATGGAAGGTCTGGCGTGGCGGCT GGGGCGCGTCACCCGCTGGCGGCTGGGCGGCGGCTGTCCCTTGCGCGAGC CGCCCGGCCGACACACGCTGACGCTACACGCCGCGCTACAGGCCACGCGG TACAACGCACAAGCGCACGCGCATGAAGCGCTGCTGACGTACTACCCGCC CCATGTGTGAGTATACATCTTTTTATAACGTACGGATGATGACCAATAAG GCCCAGAACAGACGGTGAAACGAAACTGCAACTTTCTGATGATTCTGATG AATGAAACTGAAAGTTTTAAACTGGTCGTATCATGTGTGGTCTCTCAACG GACGCTATGGCAGTAATTTGTGCAACTCAAAAGGAGTATACATCTACATT TACTATAATATAAATGCGAAAGTAACTCTGTCTGTCTGTCTGTCACGCTT TCACGCCTAAACCACTGAAGCGATTTTAATGAAATTTGGCATAGAGATAG TTTGTATCCCGGGAAAGGACATAGGATAGATTTTATCCCGGTTTTTGAAA CAGGGACGCGCGCGATAAGGTTTTTCTGTGACTGACAAAATTCCACGCGG GCGAAGCCGCGGGCGGAAAGCTAGTCTTCTTATAACGTAGGGATGATGAC CAATAAGATGTATGGGAAAGGTGATTCGTGGAACCGTGGGTTACAGGGAA TATTGGGGATTGTGTTGGAATATGGAGGTGACGTATGACGTGTAAGAAGA ATGGGGAAGGTAACACGCAGAATTAACCGTAGGTTACAGGGTATATTAGG CATGGTTACCGGGAATATGGAAATGTTCCCTGGTAATTTTGGGGTATGTT ACGGAAAATATTGCTTAGGTATGGAATAAATGATGATTTTGGGGACGTCA TATTTCTAGTTTAGATATAGTGAGACACTATAGTCCACGCGCAAAAGGTT TCCTGTTACTACAATGTTTTTCTCGATCTCGAAGCGCCTGTTAGAACTAA ATAGATAAGAAGACAATAAAGGGTGTAACTTTTTTTTACACCCTGTATGT AAAGAGCTTTTTACGGGACAAAACTCTTGCCGAATGATTGAATTAAGATT CTTCACACAATTTGATGACCGCGTACAACACTAGTCTTAATAAAATAAAT GATTAATTTATTGCAACAACATTTTGAAACTATTGGCAAACCTTTTGCGC AATGTGTGGGCTGTAACACCGGTATTGCTGAAAGAAAATAACAGAAAGTT TAAGATTAATGGTTATAGTATTACCGAGTTGAACTAAATACTGGTACCTT CTACTCGCTGCAGTAAACAGAATCGCAGGGCTTAAATAAAGGTCACGTAT GACAGAGACAATCATTGATGCGAGTAGTTAGTTTTTGAAGTGGTAACTGG TAGTTACTACTGCTGCAAAAATATCCCTTTTTTAGTACGAGAGTCTATGA CGCTGCTAGAGATAGACATTCGCTTATAATTAAGGTTATTTCTTTACCGC TGATGTACATAATGTAAAATCCATTTAATTAATGTGTAAGCTGAACATAA ACAGAATCTCATAAGCTTCCGCGTATAAATATATTCAGCTTATACGCCAT CTAGCGCGGCATTATTATACTACAAGCCCTCATGAAAGGTAACGCCATCT ACGTAGGGCTCTGAGTTATTTGCGCAGGGTATTTTCCCTTTGGCGCGAAT TTATAAACTGCCCTGTATAAATCTATGCAATGCAAGACTCAAAAGCTTAA AAGATATACGTAGAACTCTCTGATGTATGTGTAATGTGTGTGTGTGTGTG TGTGTGTGATTGGTTAACAAAATCAAATAGAATGACGATTGGATTACAAG AACTTAGATTGATCCTCAGATAAAATCTGGTAATCACAAAATGATATTTG AATTTTCGAAATGCTTGTAGTCCGAGCTTTATTCTTGGCATTAGTGCTAA CACAAATTACCATAAGTTCTAATATAAATTAAGAATAAGTACCTAATATC TTTAAATGAAAGTTATTACTATAATCAGTATCACGAAACTTGTTCCAGGT AAGCCCACTTGGAGTTTTGTAGAAGTTTCGTGGTAACTGTGTTAAATGTA TTTACATTCGTGGGAGTGTGCACATTTGCTTTTAGGGGGCTACGTGGGGC GTGTTATTGTGATTATGATGATGATGATGATGAATTTGCTTTTAGGGGGC TACGTGGGGCGTGTTATTGTGATTATGATGATGATGATGATGAGTGAAGG AATAGCGTATATTTATAACGACGTAAGGTTTAGCTAGTCGTTACTGACAT CATTGGAGTTTTTACATCAACTGCACTTATAAGGATAATACTTTTAAAAT GTACAGATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNGCGCTCGCACACTCACTGCGGGCGCCCGTCGCACAGTCGCG ACAGCAATATAATTACGCGCGAGCGATAAGGACGGGTAGCTTGGGGTCAT TGGACAAAATTCTACGTGCTCGGAGACCGGGTTTTGGAGAAATGTAACAT TACTTTCAGATGGCGATCACGAGCGCGGCAYTGCCATTGTGTTTGCAACC ACATCTGTGTGGCACACGGTCGAATTACCTCTAATATTTTCCTCCGTCCA CAGGATCGAAGACGAATGGGTGCCTGAGAAAGACGTGAAGCGGATCAAGC GTGTCGAGATAGCTACGTTGCCCGCGCACACAAAAGTACTACTCTACGAG CAGTTTTGYGCGGCGTATCGCGTCAGTCCATCCCCACCGCCGCCGAAAAA GGCCGTCCCTACCACGCGAGTTCTACCAGCGAGGCACTGCACATCCTCGC GACTCCTCAACAAGTTACTGGCGAAGCAAAAGCAGAAAAAATCGGAATGC TCCACGCCGGATCTCGCTGCGTTRTACAAGCCGCCGCCGGAACGCGTCGA AGTCAGCGGCGCCAAGAAACGCAAGATGGGCCGCCGGTATGGCGGCTACG ACGCCTTCTGGCCCTCCGGACGATAATTCCCTATCTGTRAGCTCGCTATG AATCTGTTTCGTCTTTTCTTTTAATCTGCGATAATGTAGCCTTGATTTAA GTACTATTATAGTATAACACCTTAAGTGTAGCCGCTCAGTAAGTGCCTAT TCATCAGTAAGTTAGATAACGTCTGAAA
back to top

Coding sequence (CDS) from alignment at newscf_1992:26771..37598-

>OSCA012566-RA ID=OSCA012566-RA|Name=OSCA012566-RA|organism=Ostrinia scapulalis|type=CDS|length=3681bp|location=Sequence derived from alignment at newscf_1992:26771..37598- (Ostrinia scapulalis)
ATGGCAACGTGCGGTGTGACGTTTCTAATTGAATATTATTATTGTTTCAG
TGGCGTAGCGGTGCATAGTCCGACGGAAAGCGGCGGGTGCAGCAGCAGTG
ACATCACCGAGCCGGGTTCGCCGCGCAGCCCCGAGTCGTCGTGCAGCGCG
CCAGAGGAGAGCGCGGGCGCGGGCGCGCGTATGCCGCCGTGGGCGAGCGA
GCCGGCGCCGCCGGGCCCGCGACGCCTCGCGGCCCAACCCGCGCCCGTGC
GACGCCCCCAGCCTCCCATACGACGTCGCATCACAGAATACTTCAGCCAC
AAAATGAAGCCTCAAAACGGCCTAAAGCGCGACTCCAACGCGACCAATAA
CGAAGACACCAAAAGAAAGTGCCTACCCAAAAACGGCGTCACGGACGACT
TAGAGAAATACATCTCGTATCTGTCACAGACGCTCAGTCCTAAGGTCCTG
ATGGATGTTGGGAAACAAGCAGAAACCATGAAGAAACCCAACTCTACCGT
CAACGGGGTTGTTGATTCCACCAAACCGACAGATCTCAGTAAAGTGACGC
CTAATACGAATATTAGCAGTCAGCTTGATTTCAGTAGGTCTAAGGAGKGT
AGAGAAAAAAATCATCATACCAGCATGAATGGTTTTGTTGAAGTTAGGCA
TGCGACCGAATCGTTCCAAACGACCAAAGAGAAACTTTCAAATGGGCTTC
TAAACGGGTTGGTCGACGGTAAAAAGCAGAACCTCGATAATAAAGCAACA
CCAGACCCATCCGCCAATTGCACAAAGTATAATACCACAAATACCATAGG
AGCAGCTAAAAGAAAAGTACCTATACCAATGTCAAACGAATTAAATGGAG
TAAGAATAGCACCAGCTACATCTGCCAGTCATATGCCGAAGAAATCATTG
ATTTCAAAACCTGACTCAACGAGAGTAAATGGTGTTGTTAGTTCCACTAC
TAAGTTAGATAGTAGAATGAATGGGGTCACCATTGGATCAAATAACTTAG
GTTTAAGTTCTGAAATCACCATAACGAAGAAAGAAGTTCCAAAGAAGACC
ACTCCTCAAGCTAAAAGAACAAATCGAAAATCTTCAGCTTGCATAGCTAA
CAGCAAAAACCTTACTTGGTCTAAGGTTAATAACCTGAAACAAGTACAGC
TTCAGCAAAAAAATTGTGTTAATTCTACTCAGAATTCATCCATGCAAAAT
TTACCAGGTGAAGCAAACACAGCACCAAAGATGAATATCCCAAATGGTGT
TCGTCAAGTTCCAATGACGATTAATGGGAATCTCGGTAGTATAAATGTAC
CTGTGAACAATTTACAGAACTGTCACCAAATAAATATTCCCCAGCCTTGT
AATGGAGCAGTGAATTCAAATAATTTACCTTCATTTGTAGCGGTCCCCCA
AAATGTTATGTTAGCCACGTTAAGGATACCACAGAATGGAATACCGGCAC
AAACGTTAACGCAACAAAGTAATATGACCGCTTTTAATAGGCCAAATGTC
AATGTGTCAAGCCCGACAAAGTTGAACGGCCAATTTGTGTTTCCACTCAT
GCAGAATATCAATGGAACCGTTCTGCAAATACCAAATCTAATGGCTAAAA
TGCCTAATTTTGTTCTTCCTCAAACACCGCAGCTAACAACACCCAGGCAA
GACCATTTACAGAATCAACAAACGGCACAAATTCTCATAAACGGTACTCT
TTTAAAGTTAGCTAACACGATGACGTCTACGTACCCTAATGTCAACAAGA
CGGCTCCTGTTACAAGTCAACCTATTCCTGTAATGAATAAAAACGTTCCT
GGAATACAACCCGTGGGAATAACCCATATGCAGTCCAAACCGAATTATAC
CGTTAACCTAAGCCATCCTGTTCTAATGCCTCAACCTGGGTACATAGTGA
CATCTGTGCCAAATATGAATGTGAAAGAGACATGGAGCTACACGAACACT
GCCTTATCATCATCACAAATAACGTGTTCTAATCCAATAGTCCATCACCC
GCCACCTCTAGTAGCGAACTTTACTACGGAAGCCTTACATACAAGTAGTA
TACCAATAGCGCCGGTCAAGCCGCCCGACAATCCAATTCAGGGCACAGAC
CCGCCTAGTAGTACTGTAAAAGAAGAAGTGTGTGAGGTAACAAGTTCAAA
GTATGATATACCGTGGCTTTCAAAAACTGTTAACAATAACATTGTTCCGC
TAGATTCTAATAAACTAAATTCGAGGCCTTTTGCACAAGTTTACTCGGAG
AGATTAGACGAATTTCATGTAGAGAAAGTGCGAGAAACTCTGATAGAGTC
CTCCACGATCATAGACGTTGAATGTGCTAAAGACTTAAGGAAGATTAAAG
AAGTAGCAAGAAGAGAAGAGACTATTTTCACTCAGATAACTGTGTTGAAA
GACGTTTCGTCTAACGTTCAAAGTACTGTGATAGAAGAAACTTACTGTAG
CACCACTACGGAGTCGTCAGAGTCGGGGATCGGTACTGACAAGTCTATCG
ACTCCCCGAGCGACTCGCAAACCAGTAAGGAATGTGATGACGACTCATCG
TTATCGTTAAGTATAAGTTTGTGTTCAGTGGACGTGCAGAGTAGCCAGAA
GAGTCCAATTCTGAAGCAGCCGAAAACGTTGAGGTTTCCACCGAGGAATC
CAGCGAAATCCGGTAGTAATCAAAGGACGTCAAGTACTGATACAACATCA
ACAGTTACATTATGTATGTGGGAAAACTGCAAAAGTGAATTCGAGAGTGA
CACAGATCTCTTGGAGCACTTACAGTCAGTCCATGTGGAGAGCCAAGCAG
GAAAGGAAAACTACGTGTGCCTATGGCAGAAGTGCAAGGTCCGAGGGAAG
CCCTCCTGTTCGCGGCTCTGGTTGCAAAGGCACGCCCTTTCCCACGGAGG
GAACAAACCCTTCAAATGCATCGTCGACGGCTGCGACAGAAGGTTCTCCA
CACAGATATTGTTGGAAAGGCACGTAAACAACCACTTCAACGAGGTTTCT
CCAGGGACGAACGGCAGCAAGAAAGCGGTTGATAGTGCTTCCAAGTTAAT
ACGAAGGAATGGCAAGAAACTGCGGTATAGAAGGCAACCTTGGTCGGCGC
GCATGTTCGACTTCTTCGACGCTAGCATGATGGAAGGTCTGGCGTGGCGG
CTGGGGCGCGTCACCCGCTGGCGGCTGGGCGGCGGCTGTCCCTTGCGCGA
GCCGCCCGGCCGACACACGCTGACGCTACACGCCGCGCTACAGGCCACGC
GGTACAACGCACAAGCGCACGCGCATGAAGCGCTGCTGACGTACTACCCG
CCCCATGTGATCGAAGACGAATGGGTGCCTGAGAAAGACGTGAAGCGGAT
CAAGCGTGTCGAGATAGCTACGTTGCCCGCGCACACAAAAGTACTACTCT
ACGAGCAGTTTTGYGCGGCGTATCGCGTCAGTCCATCCCCACCGCCGCCG
AAAAAGGCCGTCCCTACCACGCGAGTTCTACCAGCGAGGCACTGCACATC
CTCGCGACTCCTCAACAAGTTACTGGCGAAGCAAAAGCAGAAAAAATCGG
AATGCTCCACGCCGGATCTCGCTGCGTTRTACAAGCCGCCGCCGGAACGC
GTCGAAGTCAGCGGCGCCAAGAAACGCAAGATGGGCCGCCGGTATGGCGG
CTACGACGCCTTCTGGCCCTCCGGACGATAA
back to top
Synonyms
The feature 'OSCA012566-RA' has the following synonyms
Synonym
maker-newscf_1992-augustus-gene-0.16-mRNA-1