OSCA012567-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA012567-RA
Unique NameOSCA012567-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length540
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1992contignewscf_1992:65932..66471 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.38
QI0|-1|0|1|-1|1|1|0|179
AED0.25
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA012567OSCA012567Ostrinia scapulalisgenenewscf_1992 65932..66471 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012567-RAOSCA012567-PAOstrinia scapulalispolypeptidenewscf_1992 65932..66471 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012567-RA:exon:1045OSCA012567-RA:exon:1045Ostrinia scapulalisexonnewscf_1992 65932..66471 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012567-RA:cdsOSCA012567-RA:cdsOstrinia scapulalisCDSnewscf_1992 65932..66471 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA012567-RA ID=OSCA012567-RA|Name=OSCA012567-RA|organism=Ostrinia scapulalis|type=mRNA|length=540bp
ATGATCACACGCGGGTNGNCACTCGGCACGATCGAGTCGTTCACTGCACA
CACTATGTCACTGTCACGTATTGTCGCGGGACGAGCGGCGGCGGCGTGCG
CGGTGCGCTATCAACGCCGATGCATTGGCGGCAGTGTGCGCCGCGCTCCC
GGGCGCGCAACAGCTGACGGGAGGAGCACTCCCCCCTTCCCGAGCCGCGC
GCGCAGCCGGTGCGTGCACCCGCCCCCCGCGCCGCGCCGCCACCCCGCGC
GTCTCACCCCACCTCTAATCCATTATTTACGGACGGCCGACCGGTTTCAG
GCGCGTTCGTTCTGCCCGCCGCTTCACGACGATCGTTCAAATTTAATGCC
CTTCCTATGTCCGGCCTCTAATGCGATAAGATTACGGTCGTCGAGTTTTG
GGCCCCGCACGAATCCGGAGCATCGGCTGTGCTCGGACGATCCGCGGCAC
AGACGTCAGGGTCATCATCGATGCACGGAATGTCGGAGATGCTACAGCGG
GGACCAATTCACGAAAACGATGTCGAGGATGAGTCAATGA
back to top

spliced messenger RNA

>OSCA012567-RA ID=OSCA012567-RA|Name=OSCA012567-RA|organism=Ostrinia scapulalis|type=mRNA|length=540bp|location=Sequence derived from alignment at newscf_1992:65932..66471+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGATCACACGCGGGTMGKCACTCGGCACGATCGAGTCGTTCACTGCACA
CACTATGTCACTGTCACGTATTGTCGCGGGACGAGCGGCGGCGGCGTGCG
CGGTGCGCTATCAACGCCGATGCATTGGCGGCAGTGTGCGCCGCGCTCCC
GGGCGCGCAACAGCTGACGGGAGGAGCACTCCCCCCTTCCCGAGCCGCGC
GCGCAGCCGGTGCGTGCACCCGCCCCCCGCGCCGCGCCGCCACCCCGCGC
GTCTCACCCCACCTCTAATCCATTATTTACGGACGGCCGACCGGTTTCAG
GCGCGTTCGTTCTGCCCGCCGCTTCACGACGATCGTTCAAATTTAATGCC
CTTCCTATGTCCGGCCTCTAATGCGATAAGATTACGGTCGTCGAGTTTTG
GGCCCCGCACGAATCCGGAGCATCGGCTGTGCTCGGACGATCCGCGGCAC
AGACGTCAGGGTCATCATCGATGCACGGAATGTCGGAGATGCTACAGCGG
GGACCAATTCACGAAAACGATGTCGAGGATGAGTCAATGA
back to top

protein sequence of OSCA012567-RA

>OSCA012567-PA ID=OSCA012567-PA|Name=OSCA012567-RA|organism=Ostrinia scapulalis|type=polypeptide|length=179bp
MITRGXXLGTIESFTAHTMSLSRIVAGRAAAACAVRYQRRCIGGSVRRAP
GRATADGRSTPPFPSRARSRCVHPPPAPRRHPARLTPPLIHYLRTADRFQ
ARSFCPPLHDDRSNLMPFLCPASNAIRLRSSSFGPRTNPEHRLCSDDPRH
RRQGHHRCTECRRCYSGDQFTKTMSRMSQ
back to top

mRNA from alignment at newscf_1992:65932..66471+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA012567-RA ID=OSCA012567-RA|Name=OSCA012567-RA|organism=Ostrinia scapulalis|type=mRNA|length=540bp|location=Sequence derived from alignment at newscf_1992:65932..66471+ (Ostrinia scapulalis)
ATGATCACACGCGGGTMGKCACTCGGCACGATCGAGTCGTTCACTGCACA CACTATGTCACTGTCACGTATTGTCGCGGGACGAGCGGCGGCGGCGTGCG CGGTGCGCTATCAACGCCGATGCATTGGCGGCAGTGTGCGCCGCGCTCCC GGGCGCGCAACAGCTGACGGGAGGAGCACTCCCCCCTTCCCGAGCCGCGC GCGCAGCCGGTGCGTGCACCCGCCCCCCGCGCCGCGCCGCCACCCCGCGC GTCTCACCCCACCTCTAATCCATTATTTACGGACGGCCGACCGGTTTCAG GCGCGTTCGTTCTGCCCGCCGCTTCACGACGATCGTTCAAATTTAATGCC CTTCCTATGTCCGGCCTCTAATGCGATAAGATTACGGTCGTCGAGTTTTG GGCCCCGCACGAATCCGGAGCATCGGCTGTGCTCGGACGATCCGCGGCAC AGACGTCAGGGTCATCATCGATGCACGGAATGTCGGAGATGCTACAGCGG GGACCAATTCACGAAAACGATGTCGAGGATGAGTCAATGA
back to top

Coding sequence (CDS) from alignment at newscf_1992:65932..66471+

>OSCA012567-RA ID=OSCA012567-RA|Name=OSCA012567-RA|organism=Ostrinia scapulalis|type=CDS|length=540bp|location=Sequence derived from alignment at newscf_1992:65932..66471+ (Ostrinia scapulalis)
ATGATCACACGCGGGTMGKCACTCGGCACGATCGAGTCGTTCACTGCACA
CACTATGTCACTGTCACGTATTGTCGCGGGACGAGCGGCGGCGGCGTGCG
CGGTGCGCTATCAACGCCGATGCATTGGCGGCAGTGTGCGCCGCGCTCCC
GGGCGCGCAACAGCTGACGGGAGGAGCACTCCCCCCTTCCCGAGCCGCGC
GCGCAGCCGGTGCGTGCACCCGCCCCCCGCGCCGCGCCGCCACCCCGCGC
GTCTCACCCCACCTCTAATCCATTATTTACGGACGGCCGACCGGTTTCAG
GCGCGTTCGTTCTGCCCGCCGCTTCACGACGATCGTTCAAATTTAATGCC
CTTCCTATGTCCGGCCTCTAATGCGATAAGATTACGGTCGTCGAGTTTTG
GGCCCCGCACGAATCCGGAGCATCGGCTGTGCTCGGACGATCCGCGGCAC
AGACGTCAGGGTCATCATCGATGCACGGAATGTCGGAGATGCTACAGCGG
GGACCAATTCACGAAAACGATGTCGAGGATGAGTCAATGA
back to top
Synonyms
The feature 'OSCA012567-RA' has the following synonyms
Synonym
augustus-newscf_1992-processed-gene-0.2-mRNA-1