OSCA015085-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA015085-RA
Unique NameOSCA015085-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1401
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_200contignewscf_200:1159..2917 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.15
QI0|0|0|1|1|1|2|0|466
AED0.15
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA015085OSCA015085Ostrinia scapulalisgenenewscf_200 1159..2917 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015085-RAOSCA015085-PAOstrinia scapulalispolypeptidenewscf_200 1159..2917 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015085-RA:cdsOSCA015085-RA:cdsOstrinia scapulalisCDSnewscf_200 1159..2453 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015085-RA:exon:621OSCA015085-RA:exon:621Ostrinia scapulalisexonnewscf_200 1159..2453 -
OSCA015085-RA:exon:622OSCA015085-RA:exon:622Ostrinia scapulalisexonnewscf_200 2812..2917 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA015085-RA ID=OSCA015085-RA|Name=OSCA015085-RA|organism=Ostrinia scapulalis|type=mRNA|length=1401bp
ATGGGCGGCGCGACCATGGTGCTGGCCTACTCCACCGGGCTGGTGCTGCA
GCTGCGGAGACCTGGCTCCGAGATCCCTGTCAGCATCGCCGAGGAGTCCT
GGATTGCCGCTATGCCAGCTGTATTCAGCTTACTAGGAAGCTGTTTGACA
GCCATGGGGATGTCTCTGATCGGCCGCAGGTACACTCAGATCGCGAGCAT
CATTGTCGTGATCGTCGGCTGGCTTTTCATCGTATTCGCAAAGGACATCA
CTGTCATCCTCGTAGGACGCTTCTTCCACGGCATAGCAATGGGAGCCAGC
ATGCTATTGACTCCTATAATAAACGCTGAATACTCCAGCCCAAAATATCG
AGGAACGTTTATGCCAGTAGCGAGTTCACTGGCATCTCTTAACGTATTGA
TTTCACACAGCACAGCATTGTACTTGAGCTGGAGGACGAACGCTATAATT
TGTACTGCCATAGCTGTAGCCAATTTACTAATAGCTGTATACTCTCCAGA
ATCTCCAAGTTGGTTAGCAGCTAGACGAAGGTACGATGACTGCAGACATG
CCTTCCGGTGGCTGCGAGGTGACGACGAAGAAGAAGAATTGACCAATATG
ATCNACGCATGTGAAATGCTACACAAATCAAAAATAGAAAACGGCAAAGC
TTCAAATATGACTATCGGAAAGAAGATTGCTGAGTTCAAAATGATAATGA
CGAAGAAGGAATTCTACAAACCAGTATTAATAATGTTTCACGTGTACACG
GCGGGGTTATGGGCAGCAAGTTGGATTCTGTCAACATTCGTGTTTGACCT
CATCCCTAGCGTGGTGGGGGAAGGTTACAACCACCACGCTCTGGGTTTGA
ATATCCACAGATTTGTAGGAGGTGTTGTAGCTATTTATTTCATAACGAAA
ATTAGGAGAAGAGTTTTATTTCTGGTGGTATCTGCTTTAACAGTGATAAT
TTTACTTGCCACTGCAGCGTTTACTTATGCAAAATCGATAGGCGTTTTNA
CGTCTGATTTACCAGCTTTAGGATTATTTTTACTGCATTTACACACGGTC
GTTTTAGCTATNTGTATGATGCCTTTGCCGTTTATCATAGGTGGAGAAAT
ATTCCCTTTGAGGTACAAAAGTTTTGGGAGTGGTGTGAGCAGCACATTCT
TTTTTGTAGGCACAGCGATTCTGCTCAAGTCGTTCCCGTTTCTATTAAAC
AGCGTAGGAGTCCATGGAACATACACCATATATTCCTGTATAATATTATA
TTGTTTAGTGATATTGTATTTCTATTTACCGGAAACTAAAGATAAGACTT
TGCAAGAGATAGAAGAAGAAATGATAGGCAAACNTTGCAGCTCGGACGAA
ATGAAATCAGTTCAGCAGACGTTATTAAATGAACCTGTAATCAACGAATA
G
back to top

spliced messenger RNA

>OSCA015085-RA ID=OSCA015085-RA|Name=OSCA015085-RA|organism=Ostrinia scapulalis|type=mRNA|length=1401bp|location=Sequence derived from alignment at newscf_200:1159..2917- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGGCGGCGCGACCATGGTGCTGGCCTACTCCACCGGGCTGGTGCTGCA
GCTGCGGAGACCTGGCTCCGAGATCCCTGTCAGCATCGCCGAGGAGTCCT
GGATTGCCGCTATGCCAGCTGTATTCAGCTTACTAGGAAGCTGTTTGACA
GCCATGGGGATGTCTCTGATCGGCCGCAGGTACACTCAGATCGCGAGCAT
CATTGTCGTGATCGTCGGCTGGCTTTTCATCGTATTCGCAAAGGACATCA
CTGTCATCCTCGTAGGACGCTTCTTCCACGGCATAGCAATGGGAGCCAGC
ATGCTATTGACTCCTATAATAAACGCTGAATACTCCAGCCCAAAATATCG
AGGAACGTTTATGCCAGTAGCGAGTTCACTGGCATCTCTTAACGTATTGA
TTTCACACAGCACAGCATTGTACTTGAGCTGGAGGACGAACGCTATAATT
TGTACTGCCATAGCTGTAGCCAATTTACTAATAGCTGTATACTCTCCAGA
ATCTCCAAGTTGGTTAGCAGCTAGACGAAGGTACGATGACTGCAGACATG
CCTTCCGGTGGCTGCGAGGTGACGACGAAGAAGAAGAATTGACCAATATG
ATCRACGCATGTGAAATGCTACACAAATCAAAAATAGAAAACGGCAAAGC
TTCAAATATGACTATCGGAAAGAAGATTGCTGAGTTCAAAATGATAATGA
CGAAGAAGGAATTCTACAAACCAGTATTAATAATGTTTCACGTGTACACG
GCGGGGTTATGGGCAGCAAGTTGGATTCTGTCAACATTCGTGTTTGACCT
CATCCCTAGCGTGGTGGGGGAAGGTTACAACCACCACGCTCTGGGTTTGA
ATATCCACAGATTTGTAGGAGGTGTTGTAGCTATTTATTTCATAACGAAA
ATTAGGAGAAGAGTTTTATTTCTGGTGGTATCTGCTTTAACAGTGATAAT
TTTACTTGCCACTGCAGCGTTTACTTATGCAAAATCGATAGGCGTTTTKA
CGTCTGATTTACCAGCTTTAGGATTATTTTTACTGCATTTACACACGGTC
GTTTTAGCTATWTGTATGATGCCTTTGCCGTTTATCATAGGTGGAGAAAT
ATTCCCTTTGAGGTACAAAAGTTTTGGGAGTGGTGTGAGCAGCACATTCT
TTTTTGTAGGCACAGCGATTCTGCTCAAGTCGTTCCCGTTTCTATTAAAC
AGCGTAGGAGTCCATGGAACATACACCATATATTCCTGTATAATATTATA
TTGTTTAGTGATATTGTATTTCTATTTACCGGAAACTAAAGATAAGACTT
TGCAAGAGATAGAAGAAGAAATGATAGGCAAACYTTGCAGCTCGGACGAA
ATGAAATCAGTTCAGCAGACGTTATTAAATGAACCTGTAATCAACGAATA
G
back to top

protein sequence of OSCA015085-RA

>OSCA015085-PA ID=OSCA015085-PA|Name=OSCA015085-RA|organism=Ostrinia scapulalis|type=polypeptide|length=466bp
MGGATMVLAYSTGLVLQLRRPGSEIPVSIAEESWIAAMPAVFSLLGSCLT
AMGMSLIGRRYTQIASIIVVIVGWLFIVFAKDITVILVGRFFHGIAMGAS
MLLTPIINAEYSSPKYRGTFMPVASSLASLNVLISHSTALYLSWRTNAII
CTAIAVANLLIAVYSPESPSWLAARRRYDDCRHAFRWLRGDDEEEELTNM
IXACEMLHKSKIENGKASNMTIGKKIAEFKMIMTKKEFYKPVLIMFHVYT
AGLWAASWILSTFVFDLIPSVVGEGYNHHALGLNIHRFVGGVVAIYFITK
IRRRVLFLVVSALTVIILLATAAFTYAKSIGVXTSDLPALGLFLLHLHTV
VLAXCMMPLPFIIGGEIFPLRYKSFGSGVSSTFFFVGTAILLKSFPFLLN
SVGVHGTYTIYSCIILYCLVILYFYLPETKDKTLQEIEEEMIGKXCSSDE
MKSVQQTLLNEPVINE
back to top

mRNA from alignment at newscf_200:1159..2917-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA015085-RA ID=OSCA015085-RA|Name=OSCA015085-RA|organism=Ostrinia scapulalis|type=mRNA|length=1759bp|location=Sequence derived from alignment at newscf_200:1159..2917- (Ostrinia scapulalis)
ATGGGCGGCGCGACCATGGTGCTGGCCTACTCCACCGGGCTGGTGCTGCA GCTGCGGAGACCTGGCTCCGAGATCCCTGTCAGCATCGCCGAGGAGTCCT GGATTGGTAAGAATAGGTTTTGGTCGATAGGTCTACTCCTGCAACTCCTG GCATCTCCATGATATTTACTTGTTACTCCTAGATAGATGGATGTACCTTC TCTTTATTCTTCTACGTGTAGGCGGAAACAAAAGGCTATTCTCATAGACA TACTACTGAGCTGTGCTATACAGGGTTTAATCGGATCGATGGATTAAGGT GTCTTCCTTTCCGACAGAGAAAATCTATCTGAAATATTAACACCTTATTC ACTCCTCTTCCTCATTCTGCTACACCAATTTATCCACATCCTTCTAATTT CTACCGTGTGTGAAATAACTAGGTACTTTTACAAAATAATAATCCAAAAA CAATTTATTTTCAGCCGCTATGCCAGCTGTATTCAGCTTACTAGGAAGCT GTTTGACAGCCATGGGGATGTCTCTGATCGGCCGCAGGTACACTCAGATC GCGAGCATCATTGTCGTGATCGTCGGCTGGCTTTTCATCGTATTCGCAAA GGACATCACTGTCATCCTCGTAGGACGCTTCTTCCACGGCATAGCAATGG GAGCCAGCATGCTATTGACTCCTATAATAAACGCTGAATACTCCAGCCCA AAATATCGAGGAACGTTTATGCCAGTAGCGAGTTCACTGGCATCTCTTAA CGTATTGATTTCACACAGCACAGCATTGTACTTGAGCTGGAGGACGAACG CTATAATTTGTACTGCCATAGCTGTAGCCAATTTACTAATAGCTGTATAC TCTCCAGAATCTCCAAGTTGGTTAGCAGCTAGACGAAGGTACGATGACTG CAGACATGCCTTCCGGTGGCTGCGAGGTGACGACGAAGAAGAAGAATTGA CCAATATGATCRACGCATGTGAAATGCTACACAAATCAAAAATAGAAAAC GGCAAAGCTTCAAATATGACTATCGGAAAGAAGATTGCTGAGTTCAAAAT GATAATGACGAAGAAGGAATTCTACAAACCAGTATTAATAATGTTTCACG TGTACACGGCGGGGTTATGGGCAGCAAGTTGGATTCTGTCAACATTCGTG TTTGACCTCATCCCTAGCGTGGTGGGGGAAGGTTACAACCACCACGCTCT GGGTTTGAATATCCACAGATTTGTAGGAGGTGTTGTAGCTATTTATTTCA TAACGAAAATTAGGAGAAGAGTTTTATTTCTGGTGGTATCTGCTTTAACA GTGATAATTTTACTTGCCACTGCAGCGTTTACTTATGCAAAATCGATAGG CGTTTTKACGTCTGATTTACCAGCTTTAGGATTATTTTTACTGCATTTAC ACACGGTCGTTTTAGCTATWTGTATGATGCCTTTGCCGTTTATCATAGGT GGAGAAATATTCCCTTTGAGGTACAAAAGTTTTGGGAGTGGTGTGAGCAG CACATTCTTTTTTGTAGGCACAGCGATTCTGCTCAAGTCGTTCCCGTTTC TATTAAACAGCGTAGGAGTCCATGGAACATACACCATATATTCCTGTATA ATATTATATTGTTTAGTGATATTGTATTTCTATTTACCGGAAACTAAAGA TAAGACTTTGCAAGAGATAGAAGAAGAAATGATAGGCAAACYTTGCAGCT CGGACGAAATGAAATCAGTTCAGCAGACGTTATTAAATGAACCTGTAATC AACGAATAG
back to top

Coding sequence (CDS) from alignment at newscf_200:1159..2917-

>OSCA015085-RA ID=OSCA015085-RA|Name=OSCA015085-RA|organism=Ostrinia scapulalis|type=CDS|length=1401bp|location=Sequence derived from alignment at newscf_200:1159..2917- (Ostrinia scapulalis)
ATGGGCGGCGCGACCATGGTGCTGGCCTACTCCACCGGGCTGGTGCTGCA
GCTGCGGAGACCTGGCTCCGAGATCCCTGTCAGCATCGCCGAGGAGTCCT
GGATTGCCGCTATGCCAGCTGTATTCAGCTTACTAGGAAGCTGTTTGACA
GCCATGGGGATGTCTCTGATCGGCCGCAGGTACACTCAGATCGCGAGCAT
CATTGTCGTGATCGTCGGCTGGCTTTTCATCGTATTCGCAAAGGACATCA
CTGTCATCCTCGTAGGACGCTTCTTCCACGGCATAGCAATGGGAGCCAGC
ATGCTATTGACTCCTATAATAAACGCTGAATACTCCAGCCCAAAATATCG
AGGAACGTTTATGCCAGTAGCGAGTTCACTGGCATCTCTTAACGTATTGA
TTTCACACAGCACAGCATTGTACTTGAGCTGGAGGACGAACGCTATAATT
TGTACTGCCATAGCTGTAGCCAATTTACTAATAGCTGTATACTCTCCAGA
ATCTCCAAGTTGGTTAGCAGCTAGACGAAGGTACGATGACTGCAGACATG
CCTTCCGGTGGCTGCGAGGTGACGACGAAGAAGAAGAATTGACCAATATG
ATCRACGCATGTGAAATGCTACACAAATCAAAAATAGAAAACGGCAAAGC
TTCAAATATGACTATCGGAAAGAAGATTGCTGAGTTCAAAATGATAATGA
CGAAGAAGGAATTCTACAAACCAGTATTAATAATGTTTCACGTGTACACG
GCGGGGTTATGGGCAGCAAGTTGGATTCTGTCAACATTCGTGTTTGACCT
CATCCCTAGCGTGGTGGGGGAAGGTTACAACCACCACGCTCTGGGTTTGA
ATATCCACAGATTTGTAGGAGGTGTTGTAGCTATTTATTTCATAACGAAA
ATTAGGAGAAGAGTTTTATTTCTGGTGGTATCTGCTTTAACAGTGATAAT
TTTACTTGCCACTGCAGCGTTTACTTATGCAAAATCGATAGGCGTTTTKA
CGTCTGATTTACCAGCTTTAGGATTATTTTTACTGCATTTACACACGGTC
GTTTTAGCTATWTGTATGATGCCTTTGCCGTTTATCATAGGTGGAGAAAT
ATTCCCTTTGAGGTACAAAAGTTTTGGGAGTGGTGTGAGCAGCACATTCT
TTTTTGTAGGCACAGCGATTCTGCTCAAGTCGTTCCCGTTTCTATTAAAC
AGCGTAGGAGTCCATGGAACATACACCATATATTCCTGTATAATATTATA
TTGTTTAGTGATATTGTATTTCTATTTACCGGAAACTAAAGATAAGACTT
TGCAAGAGATAGAAGAAGAAATGATAGGCAAACYTTGCAGCTCGGACGAA
ATGAAATCAGTTCAGCAGACGTTATTAAATGAACCTGTAATCAACGAATA
G
back to top
Synonyms
The feature 'OSCA015085-RA' has the following synonyms
Synonym
maker-newscf_200-augustus-gene-0.5-mRNA-1