OSCA015672-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA015672-RA
Unique NameOSCA015672-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length228
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2582contignewscf_2582:8228..9155 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.49
QI0|0|0|0.5|1|1|2|0|75
AED0.49
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA015672OSCA015672Ostrinia scapulalisgenenewscf_2582 8228..9155 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015672-RAOSCA015672-PAOstrinia scapulalispolypeptidenewscf_2582 8228..9155 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015672-RA:exon:1154OSCA015672-RA:exon:1154Ostrinia scapulalisexonnewscf_2582 8228..8280 +
OSCA015672-RA:exon:1155OSCA015672-RA:exon:1155Ostrinia scapulalisexonnewscf_2582 8981..9155 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015672-RA:cdsOSCA015672-RA:cdsOstrinia scapulalisCDSnewscf_2582 8981..9155 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA015672-RA ID=OSCA015672-RA|Name=OSCA015672-RA|organism=Ostrinia scapulalis|type=mRNA|length=228bp
ATGGACATTATTTGCTCCTTCTTTATTGAAGTTTTGGGTGGAGAGTATGG
CAGAGTAGGTGCTGCGTTAGTTTTGTTGAATTTTGATAAAACGAACTATA
AAGATGAAGAATGGACCGACGATCTGGTGAAGATCGCGGGAGGTGCCTGG
ATGCGGGCGGCGCAGGACCGGCCATTGTGGAAATCCTTGGGGGAGGCCTT
TGTCCAGCAGTGGACGACATTTGGATGA
back to top

spliced messenger RNA

>OSCA015672-RA ID=OSCA015672-RA|Name=OSCA015672-RA|organism=Ostrinia scapulalis|type=mRNA|length=228bp|location=Sequence derived from alignment at newscf_2582:8228..9155+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGACATTATTTGCTCCTTCTTTATTGAAGTTTTGGGTGGAGAGTATGG
CAGAGTAGGTGCTGCGTTAGTTTTGTTGAATTTTGATAAAACGAACTATA
AAGATGAAGAATGGACCGACGATCTGGTGAAGATCGCGGGAGGTGCCTGG
ATGCGGGCGGCGCAGGACCGGCCATTGTGGAAATCCTTGGGGGAGGCCTT
TGTCCAGCAGTGGACGACATTTGGATGA
back to top

protein sequence of OSCA015672-RA

>OSCA015672-PA ID=OSCA015672-PA|Name=OSCA015672-RA|organism=Ostrinia scapulalis|type=polypeptide|length=75bp
MDIICSFFIEVLGGEYGRVGAALVLLNFDKTNYKDEEWTDDLVKIAGGAW
MRAAQDRPLWKSLGEAFVQQWTTFG
back to top

mRNA from alignment at newscf_2582:8228..9155+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA015672-RA ID=OSCA015672-RA|Name=OSCA015672-RA|organism=Ostrinia scapulalis|type=mRNA|length=928bp|location=Sequence derived from alignment at newscf_2582:8228..9155+ (Ostrinia scapulalis)
ATGGACATTATTTGCTCCTTCTTTATTGAAGTTTTGGGTGGAGAGTATGG CAGGTAGATTTGAATTAAGTTTTCAAAAGTTAAAAATAGATAAGCTATGA ACTCTCTATGTACTACGAAACTTTAGCTATACAATATGATCAATGTTTTA GTTTGATAGATACCAGGTCTAAGGGAATATATTTTTACTACGTAATTAAT AGAATGAATTATAAAAGGTATTTCAGGTGGCCCAATAAAGATAGACAAAA AAATCACAAACAAACAAACAAAATCTAATATCCAACTTCTCTACAACTAC TTAATATTTGAAATTTTCAAAATATTTTTGCGATTTTAAAAACTTATATC ATGATTTTCAAGACATCGTACCTAGGTCTTGTTGTTGAGACAAACCATGA AAACAAAATATATTAACAATACCTCAATTCCTTTCCTTTGTATATTGAAA CATATCAATTCCTTAAGCACACACATTGCCAATACATTTTTGAATCACAA TCACAACAGAGTAGAATGTAAATAGCATACACCGAACCTCTTTGTCGAGA GTGCTATGGCTTTTAGGAGTATTGGCCCGTCTCCACCGGTCCTTCGAGTC AAACGCCATGCATTGAGGACCGAACCCTATTGAGATTTTATTGGACGAAT TTTATATTAGAAACCCCTACCACTGTTCTCTCAAATTACTTATGCGAGTA ATGTGACATTTTTGTCCCGACGAAACTGTATACTGTCGCTTTTTCACGTC TAGAGTAGGTGCTGCGTTAGTTTTGTTGAATTTTGATAAAACGAACTATA AAGATGAAGAATGGACCGACGATCTGGTGAAGATCGCGGGAGGTGCCTGG ATGCGGGCGGCGCAGGACCGGCCATTGTGGAAATCCTTGGGGGAGGCCTT TGTCCAGCAGTGGACGACATTTGGATGA
back to top

Coding sequence (CDS) from alignment at newscf_2582:8228..9155+

>OSCA015672-RA ID=OSCA015672-RA|Name=OSCA015672-RA|organism=Ostrinia scapulalis|type=CDS|length=228bp|location=Sequence derived from alignment at newscf_2582:8228..9155+ (Ostrinia scapulalis)
ATGGACATTATTTGCTCCTTCTTTATTGAAGTTTTGGGTGGAGAGTATGG
CAGAGTAGGTGCTGCGTTAGTTTTGTTGAATTTTGATAAAACGAACTATA
AAGATGAAGAATGGACCGACGATCTGGTGAAGATCGCGGGAGGTGCCTGG
ATGCGGGCGGCGCAGGACCGGCCATTGTGGAAATCCTTGGGGGAGGCCTT
TGTCCAGCAGTGGACGACATTTGGATGA
back to top
Synonyms
The feature 'OSCA015672-RA' has the following synonyms
Synonym
maker-newscf_2582-snap-gene-0.6-mRNA-1