OSCA016581-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA016581-RA
Unique NameOSCA016581-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length885
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1991contignewscf_1991:75..23063 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.22
QI0|0|0|1|0.66|0.85|7|0|294
AED0.22
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA016581OSCA016581Ostrinia scapulalisgenenewscf_1991 75..23063 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA016581-RAOSCA016581-PAOstrinia scapulalispolypeptidenewscf_1991 75..23063 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA016581-RA:cdsOSCA016581-RA:cdsOstrinia scapulalisCDSnewscf_1991 75..221 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA016581-RA:exon:739OSCA016581-RA:exon:739Ostrinia scapulalisexonnewscf_1991 75..221 -
OSCA016581-RA:exon:740OSCA016581-RA:exon:740Ostrinia scapulalisexonnewscf_1991 1178..1363 -
OSCA016581-RA:exon:741OSCA016581-RA:exon:741Ostrinia scapulalisexonnewscf_1991 6943..7032 -
OSCA016581-RA:exon:742OSCA016581-RA:exon:742Ostrinia scapulalisexonnewscf_1991 10306..10428 -
OSCA016581-RA:exon:743OSCA016581-RA:exon:743Ostrinia scapulalisexonnewscf_1991 17941..18126 -
OSCA016581-RA:exon:744OSCA016581-RA:exon:744Ostrinia scapulalisexonnewscf_1991 22829..22860 -
OSCA016581-RA:exon:745OSCA016581-RA:exon:745Ostrinia scapulalisexonnewscf_1991 22943..23063 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA016581-RA ID=OSCA016581-RA|Name=OSCA016581-RA|organism=Ostrinia scapulalis|type=mRNA|length=885bp
ATGGCTGGCATCAGATTGCCTTCGATACCGGAAAGGGCGTCGAGACAAAT
GGCTTTGACTGGCGATTTCCCTGCCAATATGATTGGGGGGATTATCGAAT
GTGAAGAGCCGTTACCTGCAGGTTGGGAAGCTCGGATGGACAGTCACGGG
CGCGAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGAT
CTCCAAGATCCGCCGGGACACAGCATCCTTCGAGCGTTATCAACACAACC
GGGACTTAGTGGCACTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTG
CCGCTTGGTTGGGACACTAAACTGGACAGGAATGGCAAGCGTTTCTTCGT
GGACCACGTGATGCGGCGGACGACGTTCATCGACCCGCGACTGCCGCGCG
CGCCGCAAGCCGGGCCTTTTTCACCGCTGCTGCCTCAACGGCGGAGGCAC
GTTGTTGACCAGGCGCCGACGCCGCCGCCCCGGCCGCCCGTCGCGGCGGG
CGACGCGCCGCTCACCGCCCACCAGGAGATACCCGTGGCTTATAATGATA
AGGAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGATC
TCCAAGATCCGCCGGGACACAGCATCCTTCGAGCGGTATCAACACAACCG
GGACTTAGTGGCGCTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTGC
CACTTGGGTGGGACACTAAACTGGACAGGAATGGCAAGCGTTTCTTCGTG
GACCACGTGATGCGACGGACGACGTTCATCGACCCGCGTCTGCCGCGCGC
GCCGCAAGCCGGGCCTTTCTCGCCGCTGCTGCCTCAGCGGCGGAGGCACG
TTGTTGACCAGGTCGGTGTTGCTAGGGTGTGGTAG
back to top

spliced messenger RNA

>OSCA016581-RA ID=OSCA016581-RA|Name=OSCA016581-RA|organism=Ostrinia scapulalis|type=mRNA|length=885bp|location=Sequence derived from alignment at newscf_1991:75..23063- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGCTGGCATCAGATTGCCTTCGATACCGGAAAGGGCGTCGAGACAAAT
GGCTTTGACTGGCGATTTCCCTGCCAATATGATTGGGGGGATTATCGAAT
GTGAAGAGCCGTTACCTGCAGGTTGGGAAGCTCGGATGGACAGTCACGGG
CGCGAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGAT
CTCCAAGATCCGCCGGGACACAGCATCCTTCGAGCGTTATCAACACAACC
GGGACTTAGTGGCACTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTG
CCGCTTGGTTGGGACACTAAACTGGACAGGAATGGCAAGCGTTTCTTCGT
GGACCACGTGATGCGGCGGACGACGTTCATCGACCCGCGACTGCCGCGCG
CGCCGCAAGCCGGGCCTTTTTCACCGCTGCTGCCTCAACGGCGGAGGCAC
GTTGTTGACCAGGCGCCGACGCCGCCGCCCCGGCCGCCCGTCGCGGCGGG
CGACGCGCCGCTCACCGCCCACCAGGAGATACCCGTGGCTTATAATGATA
AGGAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGATC
TCCAAGATCCGCCGGGACACAGCATCCTTCGAGCGGTATCAACACAACCG
GGACTTAGTGGCGCTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTGC
CACTTGGGTGGGACACTAAACTGGACAGGAATGGCAAGCGTTTCTTCGTG
GACCACGTGATGCGACGGACGACGTTCATCGACCCGCGTCTGCCGCGCGC
GCCGCAAGCCGGGCCTTTCTCGCCGCTGCTGCCTCAGCGGCGGAGGCACG
TTGTTGACCAGGTCGGTGTTGCTAGGGTGTGGTAG
back to top

protein sequence of OSCA016581-RA

>OSCA016581-PA ID=OSCA016581-PA|Name=OSCA016581-RA|organism=Ostrinia scapulalis|type=polypeptide|length=294bp
MAGIRLPSIPERASRQMALTGDFPANMIGGIIECEEPLPAGWEARMDSHG
REASSLYNCNSTLKHMISKIRRDTASFERYQHNRDLVALVNMFSESDRDL
PLGWDTKLDRNGKRFFVDHVMRRTTFIDPRLPRAPQAGPFSPLLPQRRRH
VVDQAPTPPPRPPVAAGDAPLTAHQEIPVAYNDKEASSLYNCNSTLKHMI
SKIRRDTASFERYQHNRDLVALVNMFSESDRDLPLGWDTKLDRNGKRFFV
DHVMRRTTFIDPRLPRAPQAGPFSPLLPQRRRHVVDQVGVARVW
back to top

mRNA from alignment at newscf_1991:75..23063-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA016581-RA ID=OSCA016581-RA|Name=OSCA016581-RA|organism=Ostrinia scapulalis|type=mRNA|length=22989bp|location=Sequence derived from alignment at newscf_1991:75..23063- (Ostrinia scapulalis)
ATGGCTGGCATCAGATTGCCTTCGATACCGGAAAGGGCGTCGAGACAAAT GGCTTTGACTGGCGATTTCCCTGCCAATATGATTGGGGGGATTATCGAAT GTGAAGAGCCGTTACCTGCAGGTATGTGTACACTTCTCTTCTAGTATTAC TTGTTTTATATACGTCACTTTCTAAATTAACCAATTTATGTTAATGTCTT CAGGTTGGGAAGCTCGGATGGACAGTCACGGGCGCGTGTTCTACATAGAC CACATCAACAGGACTACAACGTGGCAGAGGCCGGGCGTCAACGGAACAGC TGCAAGGTCACCAGCGCCCGAGGTGCAGAGGAGACAGCTGGATAGGAGGT AAGTTGTTTACTGCTTTTACTTGACAAAATTTCATTCAACCGTTAATTTT TACTCGCAATACCGTGGCGTTGGTATACCCCACGCTTGCTTAGAGGCATG GGACCATTGCCTCTAATAGTCTCGAATCATCATTATCAGGTTATTTAGTC TTTTTTTTTATCCACAACGAGGAAGCTCTTGGCCTGTATCTCANNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCGAGGTCC AAATGCTGCATGATTGGTTATTTTTGACATGACATTGACAGATATGTCAA AATCCATTTAGACCTCGCGTCTACGTATTGCCATCTGGCGGATTTTTCAT ACGCGAAAACCTTCATTAAAATAGTAAGACACGGGTCTTAACGCGACGTT TATTAATGAGTGACCACGGTGGCAGCATCGCAGCCAAAACGTCAAGCCGT GAATATATAATGTAACTCATTAATAAACGTCGCGTTAAGACCCGTGTCTT ACTATTTTAAGTAAAAAATCTAAGCTTGATAAGTGAGGATACAACCCGGT CGAGTTCACTGCGCACCTGGCGGCCGTGACGTCACATCGACGCTCTGGTA CAAACGGGACGAGTGCGAGGGAGACTTGCATTCCACCGAGGTGCGCAGTT AACTCAACCGTGTTGTAACGTAAACCGTTAGCGTGGCCAATAAAGTCTTT AATTTCAATTATTTCCGAACTTTGTATGTGTGTTTGTATGTGTATGAGAC AATTTAAAAAATGTAATACCGTTACTTAACTCTAGTTAGATTTTAGGAAC AGAGCTGAAGTGGCTCTTTTTGGCCTTGCAAGTAGTTTAGGCTAGAATGG ATAATAATGCTTTAATTTATTGAGTCAGATATAACAAATACTTAATTAAA TCATCGTTGACATGATTAAACGATGCAAGATCAATAATTTCTAATTTATG ACATCGATTCAATACGATTTGAATATTCATAAAGTTCTATGCATATCTAA ACAACTGCTCATAACCGTGTTTCAATTTGAGCTCATAAAATGCACGTTTA AATCAAATTATGTAGATCAGGCCATTGAAAGATCGTTAAAAATTAATATT GAATCCGAAAATAGTATAATATACATATAATGAGTGAGATACAATAACGC TCCCGGTAACCAGTTCATGCATTTCAACTAGTGTTCCCGAGGCCTATAGG CTTTTAGGCTTTTTTTTAAGGCTAGCCTATGAATTAGGGGCTACAGCRGG AAAAAAGCCTAAAAAGGTCTTTTAGGCCTTTAGGCTAGGCCTTTTTCATA GCCTTTTTTTGTCTACCCGATGACTATAGGCTTTTAGCCTTTTTGTAGGC TAGGCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCAAAT ATTAATATTATGAGTCATTCGCTTGTAATTAAGACCTAATCATGCCATTA AGATCTCCTTTGACCAGTATTTTGGCACTTAATTTATAGTTCTCTTACTT AAGGTGCGTACGGATTGCGCGTACCCTGGTACGCGTACTCAGTTTACGCG TACTCAGTTTACGCGTACTCAGTTTACGCGTACTCAGTTTACGCGTACTC AGTTTACGCGTACTCAGTTTACGCGTACCAGGGTACGCGCAATCCGTACG CACCTTTATGCTTATAGAACTTACAGTCTAACGAAGCTGAAGTGCACCTC CTAGCTATTTCCTAACTCCGTCTTGTTATTATTCCAGGAAGCGTCTTCCC TCTACAATTGCAACTCTACCCTCAAGCACATGATCTCCAAGATCCGCCGG GACACAGCATCCTTCGAGCGTTATCAACACAACCGGGACTTAGTGGCACT GGTCAATATGTTCAGCGAGTCGGACCGAGACCTGCCGCTTGGTTGGGACA CTAAACTGGACAGGAATGGCAAGGTAACAAAGCATAGTAATGTGAAGTGA ATGTATATTTCCAAGGTATTTTCGTTACATATAGTTTGAACATTGTTTCG AAGATTATGCCCGGATGTCTTTCTAGCGTTATGTTATCAGTAAATAGACG AGATGGTGCTCAACAATATGTTCAGCGAGTCGGTAGACCGACCGTTTGGG TCAGACATTCAACTGACCAGGAATGGCATGGTTATAGTAGATAGTACCTC GATATGGTATCCAAGACCAACAGAGATTTGTCCTCCTTCGAACGTGATCA GAAAAAACGCTATTAGATGATGTTCTACAACGTTTTCAGTAAATCAGACT AACTAACGTCTAGCGCGTTTAAAATACTGCGACAGAGAGTGCTCTTTAAC GCCGTAAATGTGAAAACTAACTAACAATAAAGCTTTGTACTAACAATGCG CACGCGCATATTCTGCAGTTAGTTACGTACTTTATCATTGTGGCCACAAT AGCCCTTGAGGTGTGTAGGCAGTCTAGCCTAAAGCTCTACTATCAAAGCG CGCGCGTTTTGCAGCGTTTCTTAGTTCAGTTAGACTGAAGTTAGGTATTT AAAATAATTCGATTCCAACTTTACCCTTGCAATGCGTAGGTAGTTTAACC ACGCTAATGCTTGATACTAAGAATGCGCACGTGCACATTATACAGTGGTT AGTCCAGTTAGTTACTCAAATTGCTTACATTTTTAGGGTTCCGTACCTCA TAAGGAAAAAACGGAACCCTTATAGGATCACTTTGTTGTCCGTCCGTCCG TCTGTCAAGACCCTTTATCTCAAGAACGCGTGAACGTATCAAGCTGAAAT TCACATGAAATACTCAGGTCTATTGTCCCTTTAAGCTGTGAAAANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN CTGCCGCGCGCGCCGCAAGCCGGGCCTTTTTCACCGCTGCTGCCTCAACG GCGGAGGCACGTTGTTGACCAGGTCGGTGTTGCTAGGGTGTGGTAGATTT TGTGTGATATGGTAGATTTTGTGTGATATGGTAGATTTTGAAACGATGGC TGAAGTTTTGGTGGGATACTCAATTATTAATTGCATCCATTATAAACTAT AAATTAGAAATATGGGCCTTTGGACCGATGATCTGGTAAAGGTCGCGGGA AGAGCCTGGATGCGGGCAGCGCAGGACCGTTCATTGTGGAAAACCTTGGG GGAGACCTTTGTCCAGCAGTGGAMGTCATTTGGCTGAAACAACATGGGCC TTTACACACGGCAATTGGGAGATAGAGGGATCGGTGGGTTTTGCTTTATT TATTGGTTATTGGCGAAGAATTCGTGTTACACAAATTAAAAAATAAATCA ATTTTCCAATTTCTAAAGTAGTTAAAGTCAATCACTTACAAAAACTTTGA TTACGTCAACCAAATTCTTGTCTTCCGTAACACAGAGGAGGTTTTCTATA TCTTCACTATGACGGGCTTATCTAAAAAACTTTGAACATTTTGCCATACC ACGGTCCCACCAGAACCATTTGGCCGTCGTTTCGGAGACTTTTGTGGTGT TAAATGTGAGTGTCAGCTTTATATCTCTTTTTTTTTTGTTTCGTTTCATT TCGTTGGGTTACGGCATGACCTTACACTTGCTTTAAGTCCTAGAATTCTA CTCCGCAAATTGTTTCCAATCCGAATGTCCTACTCATCCACTACTATACG GAGCGAGAGTGAGTGAACTTAGAAGTCTCYCGGTGTAGGATTATTATCTA TACTAATATTATAAAGCTGAAGAGTGTGTTTGTTTGTTTGTTTACTTGAA CGCGCTAATCTCCGGAACTACTGGTCCGATTTGAAAAATTCTTTCAGNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNTTTGATTTAATACGTCATAAATTGTAAACCGCTACGTTTGTACGGCGG AACCCTCGGTGTGCGAGCCCGACTCGCACTTGGCCGGTTTTTTGAGACCA CCTTAATCCTTGATGCTCATAGGTAGTCTAACCAACGCCGAAGTTTGATA CACAATGCGTTCAGTTATAAAAATCAGGTACATATATTATATGCAGGTAA CATCCTAGAATGCATCCCACTTAACACCAGGTGCGATTGTGGTCAAATAC CTGCCTTGTTATGCATATTGTTTTTTTCGATTCCACCTTAACCCTCGAGA GGCCAAAGCTTACTAACACGCGCGCGCGTTTGCAGCGTTTCTTCGTGGAC CACGTGATGCGGCGGACGACGTTCATCGACCCGCGACTGCCGCGCGCGCC GCAAGCCGGGCCTTTTTCACCGCTGCTGCCTCAACGGCGGAGGCACGTTG TTGACCAGGTCGGTGTTGCTAGGGTGTGGTAGATTTTGTGTGATATGGTA GATTTTGTGTGATATGGTAGATTTTGAAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNCGTTTCCCGCAGGCGCCGACGCCGCCGCCCC GGCCGCCCGTCGCGGCGGGCGACGCGCCGCTCACCGCCCACCAGGAGATA CCCGTGGCTTATAATGATAAGGTAACTCATTTACTGACAACAGCATAATA TGTATCTTTAGTTTCTAACATACTTTTTTCCGAGTCCAAAGTTACTGCCT TTTCTGGAATTTCAATTATCGGCCAACATCTTTTTAGAACGGGTTCACGT GTGTTTTTGGCGTGTGGTTTACTATGAACGAAACGACACGTGACGTACAA AAAATGGATATGAATTTTATTACACATCTAACACTGCTATAGAGCAAGCA TATTTAATTGCTTATTTTGGGGCTAGATGTGTGAAATTGTCCAAAGATAT TTATTTATTTATAGAGCGGTTTTGCACTACGTCCAATCCGAATACAGATC TAGAAATTTTATTAGAGATGTCGGATGATTGAAATCGGACAGTGGGTGAG ATAAAACTTCCTTATAAAAAAAGTTCGTTCGACGACTACTCCGAATTCCG GACCCTATTTTCACAGATTTGGGTCAAGCGTAGTGCGAAACTGTTCTTGT TGAAGAGAAAGAGGCAATTTATTGTCTAATTTGTTGTGTAAAGCCCGGTC TGTGAGCACGTAGAATTTAGTCCAATGACCCCAAGCTACCCATCCTTATC GCTCGCGCGTAATTATGTTGCTGTCGCGCTCGCACACTCACNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTTATTAAATAAGTAATGTACGTCA ACGTACATAATAGGACTCACAGGCAGGCCAGCCGTGTCATTTGTTATTAC ATATTAGTTTATTTTGACACAACTATTAGGTTTTTGGAAATCCGGGACAG TAATGTTTAATTACTGGACACGGGACAAGACGCAAAATTCCGGGACAATC TCGGATTTCCCGGGCATCTGGCAACGCGCCGCCTCAGCATAAACGGTAAA AACGCCCGACGCGACGCTCAACGCCCCGCGTCTCTCGAAGCCCACACTCG GCCTGGTCGGCACGCGCACCGACGATCGCCAAACGGCCAGAGTACCTTCT GTACTCGCCACTCTGCCCGGTGAAGCTGGAAAAGCTCTTCAAGCTACCAA CCCTTAAAAAAACGAGCTCTTCGGGTTATCGCGAAGTGTGTAGCTAAGTA TTCGCGTATACTTCGCTTCAACTTCGCTCCGCTGTCAATGTCACCCGAAT GTTATCGTGATGTCTGTGGCCAAAGGGATACAAATATTTGCATTATACAT TTTCGAAAAGGTATCGTTTAGGAATATAACCGTGACATGTCATGTCGCGA AGATGGTTTCACGTAATTCTGACCACACGCCTGCTCGCTCAAACGCAAAC TTCCCGATCAATGTAGATTCAAGGCTCTGGCAGCCAGTGCCTTGAGTCAT AATACTTAATTTCTAGATTATGAATATCAGAAAATATATTCTAAAGCATT TCCCATTTACATATTATGCCTTGTGTGCTCAACTATTATGATAAATTGAT ATAAAAAGAAATAACCAGGTAATCTCAAATGTTATAGCTTTAGAATTAGG GTAAGAGGCCGCATTTTGATATCCACCGAATGACGCAAGCGGAACTTATA TTTTGTACATGTAACCTGACCAGTCTAAAACTATTCTATTAAAGCGCCGT GTCGTGTGTAGATGTAGAAATCTACCTTCACAGGTTATTTTTAGATATGT GTGTTTAGCGCTATCTAGTTGATAAGGGACCATACGCTAAATCCATAGGA TGTCAACAGATGTCGCCAGTGTACTGATACGGCTCTCGAATGCTAATAAT ACTATTTCTATTTCTATCATACAAAACTCAATACACTTGAAGATTTACAG CAGACTACGTCTAATTTGATTAACCATAATGTTTTTCATTATACAAAGTA ATGATKACTGTTAAAATTGTCTTTTGTTATTGTCAACCCACGTGCTTTTT GACATACAAGGCCATGTTGCTATCGATCTCCCTCGTGGTTATGCAACACA CTAGCGCCATCTAGTATCTAAGAGAGTAATCAGTAACTTCTTCGTGTTTG AACAGATGTCGCTGTTGACCATAAAATTAAATAAGTTGTGTTGTTTTTGT TTGACTGCAAAAACGATARTCGAGGCTCTCTCTATCACTCTGTATGCTAC ATTGCGAAGTTTAATAGCCTAATATATTATTATTTTCCAAGTGCGATATA TTCGTCTTTGCCTCGAGTAATAACAGCTACTTATTGTATAAGAAATACTT CCCTTGTAAAAAGATACTTTCTGACAAATAAATGCTTTCATTTTCAAATA ATGCAATATTACATAGACATTTTATTTAGGGGTGGGTTTTAATATAACAT AAATAAAATGTATACTCTTACTTAATACTTACTATTCCCTTACAGGGTGC ATTATGTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTTAGGTGGTGCAACTCAGCCTTAGTTGGCAAATAAAATTGA ATATGAACCAAGCGGTATATTTGAATGGAAAAACTAAGGCTGATTTGAAC CACCTAACTTTGACCGTAACTAAAACGATAACCGGTGTTTTTGTATGGAG TTTGACAGATTTTTGACGTTTGTCAAAGTTAAAGTTAGATGGTGCAACCC AGCCTTTAGTATTTTGCATTACCTGTAGTTTAGCTGAAGTATTCTGAAGA CTAAAATAACCAATTACCCTTCCAGATACCAATCGATCCGCCGCACTATG ACGCGCACACAACTATCCGAGGAGGAGGCACCGCCTGCGCCCGCGCCGCC CGCCGCCGGCACGTCACGCGCTTCGGAACCCCACGCCCCCCACCCCGCTG CAGAGTTTCTAGCACGACCAGACTTCTACTCCATACTGCATATGAACCAA GTGAGTTATGTTTTTAACAAGTCAAAAATCTAATATTTTAAACTTTCGCG TTCCATTTCAATTAAAATAATAATAATAATTCTTTATTTCTCACCATAGA ACACAAATATTAACAATTATAATTGTATTGTGATACAAAATGCAACTATG GTGGGTTGACACCTGAACTAGGATGAATCCTGTATGTCAGGTTATCAACC CTCCACCCCATAAAATGGTCTTACGTTAAGCCAATTACAATATCTGATCA AAATTTAAAGAATTTACAATAATTTAATTTAAGGGGTAGATAACAAATAC GTCCGCAACCGGGCGTCCAGGTAAGTGGTGTATTCGAAAGTTAGTGTGTT GTACAAGTTATGGGTTGCTGACTATTTAACAATAAGTTGCTTAAGTAACA AATCAATGCACTTACTAACTAATAAACCTATGGTAATATTGTCTTGTATG GTTTGTCAATAGTAAGTAAAATAGTAAGACACGGGTCTTAACGCGACGTT TATTAATGAGTGACCACGGTGGCAGCATCGCAGCCGAAACGTCAAGCCGT GAGTACATAATGTAACTCATTAATAAACGTCGTTTTAAGTTTTAAGACCC GTGTCTTACTATTTTAAGTAAAAAATCTAAGCTCGATAAGTGTGAGTACA ACCCGGGCAAGTTCACTGCGCATCTGGTGGCCGTGACGTCACATCGACGC TCTGGTACGAACGGGACGAACACGGGTGAGTGCGAGGAAGACTTGCATTC CAGCGAGGTGCGCAGTTAACTCAACCGGGTTATAACGTAAACCGTTAGCG GGGCCAATAAAGTCTTTAATTTCGTTTATTCCCGAACTTTGTAATGTGAC AATTTAAAAATGTAATGTCGTTACTTAACTCTAGTTAGATTTTAGGAACA GAGCTGAACTGGCCCTTTTTTGGCCTTGCAAGTAGTTTAGGCTAGAATGG ATAATAATGCTTCAATGTATTTGATTCAGATAACTTAATTAAATCATCGT TGACATGATTAAACGATGTAAGATCAATAATTTCTAATTTGCGACATCGA TTCAATACGATTTGAATATTCATAAAGATCTATGCATATCTAAATAACTG CTCATAACCGTGTTTCAATTATCAAAAACAATTTAAGATCATAAAATGCA TGTTTAAATCAAATTATGTAGATCAGGCCATTGAAAGATCGTTAAAAATT TATATCGGATCCGAAAATAGTATAATAAAATGAGTGAGATATTATAATAA CGTTCCCGGTAACCAGTTGACGCATTTCAACTGATGATATCGGCACTAAA GGTGTCCGACCGGTCACGGCGAGACATTTGTAACGCTTACAAAGTGGCGA TTAGCCATTAGTCATTAAATAACAGATATACAAACGTAATAATTTGTAAA ATGTTATCAGACTGGTCCATAATTAATGTTACCTTAACATGATGAGGTAA TAATCGACTCTATCTTGTTAATAGCAGCGGTTCTGTATTGGGAATGAAAG GACGAAAACAGTTAAAATTATTTACGTTATTAAAATCAAATATTAATTAT GAGTCATTCGCTTGTAATTAAGACATAATCATGCCATTAAGATCTCCTTT GACCAGTATTTTGGCACTTAATTTATAGTTCTCTTAAGGTGCGTACGGAT TGCGCGTACCCTGGTACGCATACTCAGTTTACGCGTATCCGGAACGCCTA GTCCATGTATGTATGGACCATGTATGCTTATAGAACTTATAGTCTAACGA AGCTGAAGTGCACCTAGACATTTCCTAACTCCGTCTTGTTGTTATTCCAG GAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGATCTC CAAGATCCGCCGGGACACAGCATCCTTCGAGCGGTATCAACACAACCGGG ACTTAGTGGCGCTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTGCCA CTTGGGTGGGACACTAAACTGGACAGGAATGGCAAGGTAATTAAGCATAG TATAGTAATTCCAACGATGGGAATGGCGGTAGCAATAGTCGAAGTCTCGA AGATCGGCTTGGAAAGATATCCTTTTAGCCTTATCAGTATATACGCGACG AGGTGGCGTTAGACTGGACATGCAGTCATAGCGCACCAGTCCTTAGCAAG AGTCGACTCTCGTTACTGGTCTACTCAGTCGAGATACTGTGTTCAAGATC AACCAGGACATATCGTCCTTCAAGTGTGTGGAGGCGATTAGTTGGGTTGG CGCTCGGTGACATACGCAATGAGTTTAAAACACTCATGTGGCACATATTT CCAGCGAGAGAGAGAGTCCACCTTAACCACCATCCACCCTTATTATGTGT AGAATAACTAAGACCAAAGCTTGATACTAACAATGCACATTTTGCAGCAG TTATTACTTCAGTTAGTTACCCAAGTATTTCATTCTTTTGCCACATTAAC CCTTGAGGCGCGTAGTCAGTGTAAACTGTAATGTAACGCCAAAGTTCTAC TATCGAAGCGCGCGCGCGTTTTGCAGCGTTTCTTAGTTCAGTTAGACTGA AGTTAGGTATTTAAAATTTTTCGATTCCAACTTAACCCTTGCAATGCGTA GGTAGTTTAACCACGCTAATGCTTGATACTAACAATGCGCACGCGCACAT TATACAGTGGTTAGTCCAGTTAGTTACTCAAATTGCTTACATTTTTTGAG TCCACCTTAACCCTTGATGCTCATAGGTAGTCTAACCAACGCCGAAGTTT GATACTGACAATGCGCAAGCGCACATGTTGTTCAGTTACAAAAGTCAGGT ATATTATTTGCAGATGTGTACCATCCTAGACTGCATCCCACTAAACACCA GGTGCGATTGTGGTCAAATACCTGCCTTGTTATGCATAAAAAAATTAACC CTCGAGACGCCAAAGCTTATTAACATGCGCGCGCGTTTGCAGCGTTTCTT CGTGGACCACGTGATGCGACGGACGACGTTCATCGACCCGCGTCTGCCGC GCGCGCCGCAAGCCGGGCCTTTCTCGCCGCTGCTGCCTCAGCGGCGGAGG CACGTTGTTGACCAGGTCGGTGTTGCTAGGGTGTGGTAG
back to top

Coding sequence (CDS) from alignment at newscf_1991:75..23063-

>OSCA016581-RA ID=OSCA016581-RA|Name=OSCA016581-RA|organism=Ostrinia scapulalis|type=CDS|length=885bp|location=Sequence derived from alignment at newscf_1991:75..23063- (Ostrinia scapulalis)
ATGGCTGGCATCAGATTGCCTTCGATACCGGAAAGGGCGTCGAGACAAAT
GGCTTTGACTGGCGATTTCCCTGCCAATATGATTGGGGGGATTATCGAAT
GTGAAGAGCCGTTACCTGCAGGTTGGGAAGCTCGGATGGACAGTCACGGG
CGCGAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGAT
CTCCAAGATCCGCCGGGACACAGCATCCTTCGAGCGTTATCAACACAACC
GGGACTTAGTGGCACTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTG
CCGCTTGGTTGGGACACTAAACTGGACAGGAATGGCAAGCGTTTCTTCGT
GGACCACGTGATGCGGCGGACGACGTTCATCGACCCGCGACTGCCGCGCG
CGCCGCAAGCCGGGCCTTTTTCACCGCTGCTGCCTCAACGGCGGAGGCAC
GTTGTTGACCAGGCGCCGACGCCGCCGCCCCGGCCGCCCGTCGCGGCGGG
CGACGCGCCGCTCACCGCCCACCAGGAGATACCCGTGGCTTATAATGATA
AGGAAGCGTCTTCCCTCTACAATTGCAACTCTACCCTCAAGCACATGATC
TCCAAGATCCGCCGGGACACAGCATCCTTCGAGCGGTATCAACACAACCG
GGACTTAGTGGCGCTGGTCAATATGTTCAGCGAGTCGGACCGAGACCTGC
CACTTGGGTGGGACACTAAACTGGACAGGAATGGCAAGCGTTTCTTCGTG
GACCACGTGATGCGACGGACGACGTTCATCGACCCGCGTCTGCCGCGCGC
GCCGCAAGCCGGGCCTTTCTCGCCGCTGCTGCCTCAGCGGCGGAGGCACG
TTGTTGACCAGGTCGGTGTTGCTAGGGTGTGGTAG
back to top
Synonyms
The feature 'OSCA016581-RA' has the following synonyms
Synonym
maker-newscf_1991-snap-gene-0.10-mRNA-1